(data stored in ACNUC1104 zone)

EMBL: CP000509.PE450

CP000509.PE450       Location/Qualifiers
FT   CDS_pept        487979..488893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80000"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW5"
FT                   /protein_id="ABL80000.1"
FT                   /translation="MTAHLGATGLANLEGHTDFDITWPWLRPGGLRPGSTAVLRVKNEA
FT                   PSLPFVLPPLLRACEFVLLVDNGSDDGTPDVARETAERAGRADRLTVTSYPFAVARAGA
FT                   EHLAQHELSVHSLAYFYNWCFSQVTTRYSWKWDGDMVLTTEGEVSIADLGWQVGDVQSI
FT                   IRVPRHGLYLESEAKGYLDLGWRNAEEWGFPIGPDFVYTKAFEWEIRTTPVGVRSIGLP
FT                   HGLCVELKYLDGEEFAHWTDPESFATSWRNRRKRREWEVFHALKEGRVPPGVHEITAPA
FT                   GVHIVDHVTHDWLPHAPRPLQVG"
     gtgaccgccc acctcggcgc caccgggctg gccaacctgg agggccacac cgacttcgac        60
     atcacctggc cgtggttgcg acccggcggg ctgcgcccgg gctcgaccgc ggtgctccgc       120
     gtgaagaacg aggcgccgtc gctgccgttc gtgctgccgc cgctgctgcg cgcgtgcgaa       180
     ttcgtgctgc tcgtcgacaa cggctcggac gacggcacgc cggacgtcgc ccgcgagacc       240
     gccgagcgcg cgggccgggc ggaccggctg acggtgacgt cgtacccctt cgcggtggcg       300
     cgcgccggcg ccgagcacct ggcccagcac gagctgtcgg tgcactcgct ggcgtacttc       360
     tacaactggt gcttctccca ggtcaccacc cgctactcct ggaagtggga cggcgacatg       420
     gtgctcacca ccgagggcga ggtctcgatc gccgacctcg gctggcaggt cggtgacgtg       480
     cagtcgatca tccgggtgcc gcggcacggg ctctacctgg agagcgaggc caagggctac       540
     ctcgacctcg gctggcgcaa cgccgaggag tgggggttcc cgatcgggcc ggacttcgtc       600
     tacacgaagg ccttcgagtg ggagatccgc accacgcccg tcggcgtgcg ctcgatcggg       660
     ctgccgcacg gcctgtgcgt cgagctgaag tacctcgacg gcgaggagtt cgcgcactgg       720
     accgacccgg agtcgttcgc gaccagctgg cgcaaccgtc gcaagcgccg cgagtgggag       780
     gtcttccacg ccctcaagga gggccgggtg ccgcccggcg tgcacgagat caccgcgccc       840
     gccggcgtcc acatcgtcga ccacgtcacc cacgactggc tcccgcacgc cccgcgcccg       900
     ctccaggtcg gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page