(data stored in ACNUC1104 zone)

EMBL: CP000509.PE451

CP000509.PE451       Location/Qualifiers
FT   CDS_pept        489233..490051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80001"
FT                   /db_xref="GOA:A1SDW6"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW6"
FT                   /protein_id="ABL80001.1"
FT                   /translation="MVAAAGESDASRARIADLLPGTRTAKPTDVARSCDLLLLTVPDDM
FT                   LGNVVTVLSDSGAIRPGQYVVHTSGRHGLAVLEPAARAGAHPVAMHPAMTFTGTALDLD
FT                   RLPGCVYGLTAEPSERVFTEGLVADLRGRPTWVPEEMRTLYHGGLAHGANHLVTLVSQA
FT                   MELLAAAGCDHPAGTLRPLLTAALDNALEQGDSALTGPIVRGDVNTVRAHLADIATNAP
FT                   HTLPSYVALARDTLDRVVTDGRVLPIRAAAIKRALEQAEQAAPRTTAPRR"
     gtggtcgccg ccgccggcga gtccgacgcc tcccgcgcgc ggatcgccga cctgctgccc        60
     ggcacccgta ccgcgaagcc gaccgacgtg gcgcgctcct gcgacctgct gctgctgacg       120
     gtccccgacg acatgctcgg caacgtcgtc accgtgctga gcgacagcgg cgccatcagg       180
     cccggccagt acgtcgtgca cacctccggc cgccacggcc tcgcggtgct cgagcccgcg       240
     gcccgcgccg gcgcgcaccc ggtcgcgatg caccccgcga tgaccttcac cggtaccgcg       300
     ctcgacctcg accggctgcc cggctgcgtc tacggtctga ccgccgagcc gtcggagcgg       360
     gtgttcaccg agggcctggt cgccgacctg cggggccggc cgacctgggt gcccgaggag       420
     atgcgcaccc tctaccacgg tggtctcgcc cacggcgcca accacctggt gacgctggtg       480
     agccaggcga tggagctgct ggcggccgcc ggttgcgacc accccgccgg gacactgcgc       540
     cccctgctga ccgcagccct ggacaacgcg ctcgagcagg gcgacagcgc gctgaccggc       600
     ccgatcgtgc gcggcgacgt caacaccgtg cgcgcccacc tcgccgacat cgcgaccaac       660
     gccccgcaca ccctgccgtc gtacgtcgcc ctcgcccgcg acaccctcga ccgcgtggtg       720
     accgacggcc gggtgctgcc gatccgtgcg gccgcgatca agcgggcgct ggagcaggcc       780
     gagcaggccg cgcccaggac gaccgcgccc cgtcgatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page