(data stored in ACNUC1104 zone)

EMBL: CP000509.PE456

CP000509.PE456       Location/Qualifiers
FT   CDS_pept        494111..494884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0464"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bordetella pertussis Bvg accessory factor;
FT                   KEGG: sma:SAV4690 putative Bordetella pertussis Bvg
FT                   accessory factor family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80006"
FT                   /db_xref="GOA:A1SDX1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDX1"
FT                   /protein_id="ABL80006.1"
FT                   /translation="MPLLCADIGNSHTVLGLVSGGSVLADWRVATDERNTADDWSVLLR
FT                   GLLGAALEEIDGIAVCATVPAVLHEWREMLTRHFPAVRHVVVEPGVRTGVPVLMDNPRE
FT                   VGTDRIINALAAVHEYGGPAIVVDFGGTATTFDVVSAQGQYVGGSISPGIELSLESLGR
FT                   RGAQLRKVELLRPRSVIAKNTVEALQSGMVFGVAAQVEGIVDRMIGELGVGATDVQVIA
FT                   TGYLAPVVLDECRCFTHHAPWLTLRGLELVFERNA"
     gtgccgctgc tctgtgccga catcggcaac agccacacgg tcctcggcct ggtctccggg        60
     ggcagcgtgc tcgccgactg gcgggtggcc accgacgagc gcaacacggc ggacgactgg       120
     tcggtgctgc tgcgcgggct gctcggcgcg gccctcgagg agatcgacgg gatcgcggtc       180
     tgcgccaccg tgccggcggt gctgcacgag tggcgcgaga tgctcacccg gcacttcccg       240
     gcggtgcggc acgtcgtcgt cgagccggga gtgcgcaccg gtgtccccgt gctgatggac       300
     aacccccgcg aggtcggtac cgaccggatc atcaacgcac tggccgccgt ccacgagtac       360
     ggcgggcccg cgatcgtggt cgacttcggc ggcacggcga cgacgttcga cgtcgtgagc       420
     gcgcagggcc agtacgtcgg cggctcgatc tccccgggaa tcgagctctc gctggagtcg       480
     ctcggccgcc ggggtgcaca gctgcggaag gtcgaattgc tgcggccgcg ctcggtgatc       540
     gcgaagaaca ccgtcgaggc gctccagtcc gggatggtct tcggcgtcgc cgcgcaggtc       600
     gagggaatcg tcgaccggat gatcggcgag ctcggcgtcg gtgccaccga cgtgcaggtc       660
     atcgcgaccg gttacttggc gccggtggtg ctcgacgagt gccgctgctt cacccaccac       720
     gcgccctggt tgacgctgcg tggcctcgaa ttggtcttcg agcgcaacgc ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page