(data stored in SCRATCH zone)

EMBL: CP000509.PE457

CP000509.PE457       Location/Qualifiers
FT   CDS_pept        495060..495386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80007"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX2"
FT                   /protein_id="ABL80007.1"
FT                   /translation="MAQKVNIVLVDDIDGSEATETVTFGLDGTTYEIDLNDKNAAALRD
FT                   VFSGYVGHARKVGAAPRRARRAAAASSGPSAKEIRDWARSNGHDVPDRGRVSAEVREAY
FT                   DRAH"
     atggcgcaga aggtcaacat cgttctcgtc gacgatatcg acggcagcga ggccaccgag        60
     acggtgacgt tcggcctgga cggcaccacc tacgagatcg acctcaacga caagaacgcc       120
     gcggcgctgc gcgacgtctt ctccggctac gtcgggcacg cccgcaaggt cggcgccgca       180
     ccgcgtcggg cccggcgagc cgcggccgcg agcagcggcc ccagcgccaa ggagatccgc       240
     gactgggcgc gctccaacgg gcacgacgta cccgaccgcg ggcgggtctc cgccgaggtg       300
     cgcgaggcct acgaccgggc acactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page