(data stored in ACNUC1104 zone)

EMBL: CP000509.PE458

CP000509.PE458       Location/Qualifiers
FT   CDS_pept        495691..498276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0466"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
FT                   protein; Clp N terminal domain protein; ATPase associated
FT                   with various cellular activities, AAA_5; ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase; KEGG: sma:SAV4697
FT                   putative ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80008"
FT                   /db_xref="GOA:A1SDX3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX3"
FT                   /protein_id="ABL80008.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLSHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLDISLEAVRAQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHSYIG
FT                   TEHILLGLIREGEGVAAQVLQKLGADLNRVRQQVIQLLSGFQGKESAGSAAATGASGGD
FT                   APSSSLVLDQFGRNLTQDAREGKLDPVIGREQEIERVMQILSRRTKNNPVLIGEPGVGK
FT                   TTIVEGLAQDIVKGNVPETLKDKQIYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGD
FT                   IVLFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYLEKDAALER
FT                   RFQPIQVAEPSIAHTIEMLKGLRDRYEAHHRVTITDEALVSAATLADRYISDRFLPDKA
FT                   IDLIDEAGSRLRIRRMTAPADLREYDDKIGEVRQRKEAAIDGQDFEAAARLRDEEKQLI
FT                   LKKSEREKQWRAGDMDEVAEVDEELIAEVLAVATGIPIVKLSEEESTRLLKMEDELHKR
FT                   VIGQEEAVKALSRAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTWLSKTLAEFLFGDEDA
FT                   LIQLDMSEFGEKHTVSRLFGSPPGYVGYEEGGQLTEKVRRKPFSVVLFDEVEKAHPDIF
FT                   NSLLQILEEGRLTDSQGRVVDFKNTVIIMTTNLGTRDIAKGINLGFQQSGDAAGSYERM
FT                   KSKVSEELKQHFRPEFLNRVDEVIVFPPLSQEQIVHMVDNMIASVELRMKDRDMRIELT
FT                   QNAKNLLAERGFDPVLGARPLRRTIQREIEDVLAEKMLYGEVGPGQIVLVDVEGEGPTA
FT                   TFTFSGQKVGDLPDLPPFETAEVTSSEATPPTEGPDDSDSGTDVPKSTD"
     atgttcgagc ggttcactga ccgagcccgc cgggtggtcg tgctggccca ggaagaggcc        60
     cgcatgctct cccacaacta catcggcacc gagcacatcc tgctcggcct catccacgag       120
     ggcgagggtg tggccgcgaa ggctctcgag agcctggaca tctcgctcga ggcggtccgg       180
     gcccaggtgg aggagatcat cggccagggc cagcaggccc cgagcgggca catcccgttc       240
     accccgcgcg ccaagaaggt gctcgagctg tccctgcgtg aggcgctcca gctcggccac       300
     tcctacatcg gcaccgagca catcctgctc ggcctgatcc gtgagggtga gggcgtcgcc       360
     gcccaggtgc tgcagaagct cggcgccgac ctgaaccggg tccgccagca ggtcatccag       420
     ctgctctcgg gcttccaggg caaggagtcg gcgggatccg ccgcggccac cggcgcctcc       480
     ggcggcgacg cgccgtcctc ctcgctggtg ctcgaccagt tcggccgcaa cctcacccag       540
     gacgcgcgcg agggcaagct ggacccggtc atcggccggg agcaggagat cgagcgggtc       600
     atgcagatcc tgtcccggcg taccaagaac aacccggtcc tgatcggcga gcccggcgtc       660
     ggcaagacga ccatcgtcga gggcctggcc caggacatcg tcaagggcaa cgtgccggag       720
     acgctgaagg acaagcagat ctacaccctc gacctgggtg cgctggtcgc cgggtcgcgc       780
     taccgcggcg acttcgagga gcgcctgaag aaggtgctca aggagatccg cacccgcggc       840
     gacatcgtgc tgttcatcga cgagatccac accctcgtcg gcgccggtgc ggccgagggc       900
     gcgatcgacg cggcgagcat cctcaagccg atgctggccc gcggcgagct gcagaccatc       960
     ggcgcgacca ccctggacga gtaccgcaag tacctcgaga aggacgccgc gctcgagcgc      1020
     cgcttccagc cgatccaggt ggccgagccg tcgatcgcgc acaccatcga gatgctcaag      1080
     gggctgcgcg accgctacga ggcccaccac cgcgtgacga tcaccgacga ggcgctcgtc      1140
     tcggccgcga cgctcgcgga ccgctacatc tccgaccggt tcctgcccga caaggcgatc      1200
     gacctgatcg acgaggccgg ctcgcggctg cggatccgcc ggatgacggc gcccgccgac      1260
     ctgcgcgagt acgacgacaa gatcggcgag gtgcgccagc gcaaggaggc cgcgatcgac      1320
     ggccaggact tcgaggccgc cgcgcggctg cgcgacgagg agaagcagct gatcctcaag      1380
     aagtccgagc gcgagaagca gtggcgtgcg ggtgacatgg acgaggtcgc ggaggtcgac      1440
     gaggagctga tcgccgaggt gctcgcggtg gcgaccggca tcccgatcgt gaagctgtcc      1500
     gaggaggagt cgacccggct gctcaagatg gaggacgagc tgcacaagcg ggtgatcggc      1560
     caggaggagg ccgtcaaggc gctcagccgc gccatccggc gtacccgcgc cggcctgaag      1620
     gacccgaagc gccccggcgg gtcgttcatc ttcgccggcc cctccggtgt cggcaagacc      1680
     tggctgtcca agacgctcgc ggagttcctc ttcggcgacg aggacgcctt gatccagctc      1740
     gacatgtcgg agttcggcga gaagcacacc gtctcccggc tgttcggctc gcctcccggc      1800
     tacgtcggct acgaggaggg cggccagctc accgagaagg tgcgccgcaa gccgttctcg      1860
     gtcgtgctct tcgacgaggt cgagaaggcg cacccggaca tcttcaacag cctgctgcag      1920
     atcctcgagg aaggtcgcct gaccgactcg cagggccggg tggtcgactt caagaacacc      1980
     gtcatcatca tgaccaccaa cctcggcacg cgcgacatcg ccaagggcat caacctcggc      2040
     ttccagcaga gcggcgacgc ggccggctcc tacgagcgga tgaagagcaa ggtgtcggag      2100
     gagctcaagc agcacttccg gccggagttc ctcaaccggg tcgacgaggt catcgtgttc      2160
     ccgccgctgt cgcaggagca gatcgtccac atggtcgaca acatgatcgc gtcggtcgag      2220
     ctgcggatga aggaccgcga catgcggatc gagctgaccc agaacgcgaa gaacctgctc      2280
     gccgagcggg gcttcgaccc ggtgctgggt gctcgcccgc tgcgccggac gatccagcgc      2340
     gagatcgagg acgtgctcgc cgagaagatg ctgtacggcg aggtcggccc cggccagatc      2400
     gtgctcgtcg acgtggaggg cgagggcccg accgcgacgt tcacgttctc cggccagaag      2460
     gtcggcgacc tgcccgacct gccgccgttc gagaccgcgg aggtgacctc cagcgaggcg      2520
     acccccccga ccgagggccc ggacgactcc gacagcggca ccgacgtacc caagtccacc      2580
     gactga                                                                 2586
//

If you have problems or comments...

PBIL Back to PBIL home page