(data stored in ACNUC1104 zone)

EMBL: CP000509.PE459

CP000509.PE459       Location/Qualifiers
FT   CDS_pept        complement(498338..499204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0467"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: sco:SCO3355 putative adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80009"
FT                   /db_xref="GOA:A1SDX4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX4"
FT                   /protein_id="ABL80009.1"
FT                   /translation="MNELHAPVLQWYDEHARDLPWRRAEAGPWSVLVSEFMLQQTPVAR
FT                   VLPVHEQWLARWPQPADLAAESAGEAVRAWGRLGYPRRALRLHAAATAILERHDGAVPS
FT                   SYDDLIALPGVGDYTAAAIAVFAYGRRHVVLDTNVRRVLTRTLQGVEFPAPSVTRAERE
FT                   LALAVLPADEPTAATWSVAVMELGALVCTAANPRCADCPVARLCAWRTAGYPAYDGPKR
FT                   LVQTWAGTDRQCRGRLLAVLREDDGPVHRSRLDAVWSEEAQRVRCLASLAADGLVVHVG
FT                   PDAYALP"
     atgaacgagc tccatgcacc cgtgctgcag tggtacgacg agcacgcccg cgacctgccc        60
     tggcgacgcg cggaggccgg tccgtggtcg gtgctggtct cggagttcat gctgcagcag       120
     acccccgtcg cccgggtgct gcctgtccac gagcagtggc tggcccggtg gccgcagccg       180
     gccgacctcg cggccgagtc cgccggcgag gcggtgcgcg cctggggtcg cctgggctac       240
     ccacgccgag cgctgcgcct gcacgccgcg gccacggcga tcctcgagcg gcacgacggc       300
     gccgtgccgt cgtcgtacga cgacctgatc gcgctgcccg gggtcggcga ctacaccgcc       360
     gcggcgatcg cggtgttcgc gtacgggcgg cggcacgtcg tgctcgacac caacgtgcgg       420
     cgggtgctca cgcggacgct gcagggcgtg gagttcccgg cgccgtcggt gacccgcgcc       480
     gagcgcgagc tggccctggc ggtgctgccc gcggacgagc cgaccgcggc gacctggtcg       540
     gtcgcggtga tggagctcgg ggcgctcgtg tgcacggcgg ccaacccgcg gtgcgccgac       600
     tgcccggtcg cccggctgtg cgcgtggcgc acggccggct acccggcgta cgacgggccc       660
     aagcgcctgg tgcagacctg ggccggcacc gaccgccagt gccgcggccg gctgctcgcc       720
     gtgctccgcg aggacgacgg gcccgtgcac cgcagccggc tcgacgccgt ctggtcggag       780
     gaggcccagc gggtccgctg cctcgcctcg ctggcggccg acgggctggt cgtccacgtc       840
     ggcccggacg cctacgcgct gccctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page