(data stored in ACNUC1104 zone)

EMBL: CP000509.PE46

CP000509.PE46        Location/Qualifiers
FT   CDS_pept        complement(51689..52852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0046"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   ppu:PP_3725 acyl-CoA dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79596"
FT                   /db_xref="GOA:A1SCR1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR1"
FT                   /protein_id="ABL79596.1"
FT                   /translation="MTLAPDELEEMAATTRRFIRERIHPIEQEVDDTDHIDPQVWQSLV
FT                   DESVELGLYTANVPETLGGPGLTIAEQTRLWEEFGHTSWPFSYLLARPHRVLFACTEEQ
FT                   RSRYLDPVLAGKRAQCFALTEPGAGSDNSAMRTRAEKVEGGYVLNGAKHFISHGNADFA
FT                   IVFAVTGPPLRGRTPQVTAFLVDRGTPGFTVGKAQRMMGWSGMEECELVFENCFVPDDQ
FT                   VLGTPGEALRLGLASVAQRRLQMAAYCVGAMERLLGLSIAYTRDRVVFDEPLFDKQGIR
FT                   WMLAEAAMEPYLAREATYKAARLCDEARAAGRSEIELSRLFAREISIAKLHATRALNRV
FT                   ADVAVQVHGGMGWCREYPVERLYRDARVFRIIEGADEVHKEIIAKAL"
     atgacgctgg cacccgacga gctcgaggag atggccgcca ccacgcggcg gttcatccgg        60
     gagcgtatcc accccatcga gcaggaggtc gacgacaccg accacatcga tccccaggtc       120
     tggcagtccc tggtcgacga gtcggtcgag ctcggtctct acacggcgaa cgtgccggag       180
     accctcggcg ggccgggtct cacgatcgcc gagcagaccc gcctgtggga ggagttcggc       240
     cacacctcgt ggccgttcag ctacctgctc gcgcggccgc accgagtgct cttcgcctgc       300
     accgaggagc agcgttcgcg ctacctcgac cccgtcctcg cgggcaagcg ggcccagtgc       360
     ttcgccctca ccgagcccgg cgccgggtcg gacaactccg cgatgcgcac ccgcgcggag       420
     aaggtcgaag gaggctacgt cctcaacggc gcgaagcact tcatcagtca cggcaacgcc       480
     gacttcgcga tcgtcttcgc cgtcacgggt cccccgctgc gcggccgcac gccgcaggtc       540
     acggcgttcc tcgtcgaccg tgggacgccg ggcttcaccg tcggcaaggc ccagcggatg       600
     atgggctggt cgggcatgga ggagtgcgag ctcgtcttcg agaactgctt cgtgcccgac       660
     gaccaggtgc tgggcacccc cggcgaggcc ctgcgcctcg ggctggcgtc ggttgcgcag       720
     cgtcggctcc agatggccgc ctactgcgtc ggcgccatgg agcggctgct cgggctgagc       780
     atcgcctaca cgcgcgaccg ggtcgtcttc gacgagcctc tcttcgacaa gcagggcatc       840
     cgctggatgc tggccgaagc cgccatggag ccgtacctcg cccgcgaggc gacctacaag       900
     gcagcccgcc tgtgcgacga ggcgcgcgct gccggccggt cggagatcga gctgtcacgg       960
     ttgttcgctc gcgagatctc gatcgccaag ctgcacgcca cgcgcgccct gaaccgggtg      1020
     gcggacgtcg ccgtccaggt gcacggcggc atggggtggt gtcgggagta cccggtcgaa      1080
     cgtctctacc gggacgcgcg cgtgttccgg atcatcgagg gcgccgacga ggtccacaag      1140
     gagatcatcg ccaaagcgct ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page