(data stored in ACNUC1104 zone)

EMBL: CP000509.PE460

CP000509.PE460       Location/Qualifiers
FT   CDS_pept        499269..500069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX5"
FT                   /protein_id="ABL80010.1"
FT                   /translation="MPALTRGPLPARVYWVRRLLVLGTATLLVVAIARLLGGGSDAASE
FT                   PDAGAQLVADGSPTAAATLDGEPTTTTSARKPGKRASKSQEPVLAQPDGPCADEDVAIT
FT                   PKVENAVAGRPVQIVLQLRTLESDACTWRVSAGTVTVNITSGPDDIWTSRQCRRAIPAR
FT                   DVVVRKAVTSNVSITWSSRRSDDGCTRLTDWAYPGWYHVTAAALAGEPSDAQFELRTPT
FT                   AATITKTVTPTQKPSQKPSQSASGRPVTPGQGQSASPSGAVEPN"
     atgcccgccc tcacccgtgg cccgctgccc gcgcgcgtct actgggtacg tcggctgctc        60
     gtgctcggca ccgcaaccct gctcgtcgtg gcgatcgccc ggctcctcgg cggcggcagc       120
     gacgccgcct cggaacctga cgccggggcg cagctggtcg cggacggctc cccgaccgca       180
     gcggcgacgc tcgacggcga gccgacgacc acgacgtcgg cccgaaagcc cggcaagcgc       240
     gcctcgaaga gccaggagcc ggtgctcgcc cagcccgacg gaccgtgcgc ggacgaggac       300
     gtggcgatca ccccgaaggt cgagaacgcc gtcgccgggc ggccggtcca gatcgtgctg       360
     cagctgcgca ccctcgagtc cgacgcctgc acgtggcggg tctcggcggg caccgtgacg       420
     gtcaacatca cctctggccc cgacgacatc tggaccagcc gccagtgccg gcgggcgatc       480
     ccggcccggg acgtggtcgt gcgcaaggcc gtcacgagca acgtctcgat cacctggagc       540
     tcgcgccgct cggacgacgg ctgcacccgg ctcaccgact gggcctaccc cggctggtac       600
     cacgtcaccg ccgccgcgct ggccggcgag ccctcggacg cacagttcga gctgcggacg       660
     ccgacggccg cgacgatcac gaagaccgtg acgcctaccc agaagcccag ccagaagccc       720
     agccagagcg ccagcggccg gccggtcacc ccggggcagg ggcagagcgc ctcgccgtcc       780
     ggggccgtcg agccgaactg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page