(data stored in SCRATCH zone)

EMBL: CP000509.PE463

CP000509.PE463       Location/Qualifiers
FT   CDS_pept        503013..504032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0471"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sth:STH770
FT                   LacI family transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80013"
FT                   /db_xref="GOA:A1SDX8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX8"
FT                   /protein_id="ABL80013.1"
FT                   /translation="MARVSTTPPTLADVAERAGVSRQTVSNAVNNPDLLRADTLARVLH
FT                   AIDELGYSPNRAARNLRTRASHLVGMRIGPVYEGTANATMDRFVHSLVEASREAGYHVL
FT                   LFAGDPEDPVAGYDDLLRSTTVDAFVVTDTYLGNPQATWLEERRAPFVAFGRPWDNPAA
FT                   EHPWVDVDGAAGTDLATSYLLGRGHERIAWIGWRKDSWIGEDRRSGWSRALHARGLPTT
FT                   GLASRVEDTVSSGREASAVLLDEARPTAFVCASDTLAMGVLGTLADRGLTPGRDVSVIG
FT                   FDDSQVAQVVSPGLTSVRQPLEEVAVEIVKALEGLLGHPPTVGPGVMLVPSLALRGTS"
     gtggcgcggg tctcgacgac cccgccgacc ctggccgacg tcgccgagcg cgccggcgtc        60
     tcccggcaga cggtgtcgaa cgccgtgaac aaccccgacc tgctgcgcgc cgacaccctg       120
     gcccgggtgc tgcacgcgat cgacgagctc ggctactcgc ccaaccgggc cgcccgcaac       180
     ctgcgcaccc gcgccagcca cctggtcggg atgcggatcg ggccggtcta cgagggcacg       240
     gccaacgcca cgatggaccg gttcgtgcac tccctggtgg aggcctcgcg cgaggcgggc       300
     taccacgtcc tgctgttcgc gggtgacccc gaggacccgg tggccgggta cgacgacctg       360
     ctccgctcca ccaccgtcga cgcgttcgtc gtcaccgaca cctacctcgg caatccgcag       420
     gccacctggc tcgaggagcg gcgggccccg ttcgtcgcgt tcggacggcc gtgggacaac       480
     ccggcggccg agcacccctg ggtcgacgtg gacggcgcgg ccggcaccga cctggcgacg       540
     tcgtacctcc tcggccgcgg ccacgagcgg atcgcctgga tcggctggcg caaggactcc       600
     tggatcggtg aggaccgccg ctcgggatgg agccgcgccc tgcacgcccg cgggctgccc       660
     accaccggcc tggcgtcgcg ggtcgaggac accgtctcga gcggccgcga ggcgagcgcc       720
     gtcctgctgg acgaggcccg gcccaccgcg ttcgtgtgcg cgtccgacac cctcgccatg       780
     ggggtgctcg gcaccctcgc cgaccgcggc ctgacgcccg gtcgggacgt gtcggtgatc       840
     ggcttcgacg actcgcaggt cgcgcaggtc gtctcgcccg gcctcacctc ggtgcgccag       900
     ccgctcgagg aagtggccgt ggagatcgtc aaggcgctcg agggcctgct cggccacccg       960
     cccaccgtcg gccccggcgt gatgctggtc ccgagcctcg ccctccgcgg caccagctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page