(data stored in ACNUC1104 zone)

EMBL: CP000509.PE464

CP000509.PE464       Location/Qualifiers
FT   CDS_pept        complement(504157..504912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0472"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rha:RHA1_ro06583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80014"
FT                   /db_xref="GOA:A1SDX9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX9"
FT                   /protein_id="ABL80014.1"
FT                   /translation="MDDPRSHAIARPVRQLSRGRVRATEGARPSPNIWQHPATYEIENR
FT                   AVDPDGLLAAAMLAVDRWADRTVLDVGCGTGFHLPWFAETAASVIGVEPHADLVALARR
FT                   RSRRLANVTVHQGVAQSLPLPDASVDVVHARWAYFFGPGCEPGLAELDRVVRRGGTAYV
FT                   IDNDPTRSTFGGWFRRGYPEVDPVAVERFWSARGWTRVPLDLRWSFSSRADLEAVVRIE
FT                   FTPQVADQVLPEHAGTEVDYAVNLWWKRF"
     atggacgatc cgcgcagcca cgcgatcgcc cgtcccgtcc ggcagctgtc tcgcggccgc        60
     gtgcgggcga ccgagggcgc gcgcccgagc ccgaacatct ggcagcaccc cgcgacctac       120
     gagatcgaga accgcgcggt cgaccccgac gggctgctgg ccgcggccat gctggcggtc       180
     gaccggtggg ccgatcgcac cgtgctcgac gtcggctgcg gcaccggctt ccacctgccg       240
     tggttcgccg agaccgcggc gtcggtgatc ggcgtcgagc cgcacgccga cctggttgcg       300
     ctcgcgcggc ggcgcagccg gcggctcgcg aacgtgacgg tgcaccaggg cgtcgcccag       360
     tccctgcccc tcccggacgc ctcggtcgac gtcgtccacg cccgctgggc ctacttcttc       420
     gggcccggct gcgagcccgg gttggccgag ctggaccggg tggtgcgccg cggcggcacg       480
     gcgtacgtca tcgacaacga cccgacccgc tccacgttcg gcgggtggtt ccggcgcggc       540
     taccccgagg tcgacccggt cgcggtcgag cggttctggt ccgcccgcgg ctggacccgc       600
     gtgcccctcg acctgcgctg gtccttctcg agtcgcgccg acctggaggc ggtggtgcgg       660
     atcgagttca ccccccaggt cgccgaccag gtgctccccg agcacgccgg caccgaggtc       720
     gactacgccg tcaacctgtg gtggaagcgg ttctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page