(data stored in ACNUC1104 zone)

EMBL: CP000509.PE465

CP000509.PE465       Location/Qualifiers
FT   CDS_pept        complement(504920..505558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80015"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY0"
FT                   /protein_id="ABL80015.1"
FT                   /translation="MRLDHLSFAAGPDGLASTAQRIGRLLGRDFVDGGVHPRFGTRNMI
FT                   LPLAGNTYLEVVEVLDHPASDKAPFGQAVRARSALGGGWLGWVVAVDDITVVERRLGRE
FT                   AVVGSRHRPDGTELRWKQIGVNGLIADPQLPFFIEWEIPAELHPSAGADEAFSLACLEI
FT                   AGDPHRVSEWLGETVEAPLEDVKVEWAAPNGTPGIGAAQFQTPSGLVRL"
     atgcgcctgg atcatctttc tttcgcagcc ggaccggacg gcctcgccag taccgctcag        60
     cgcatcggcc gtctgctcgg ccgggacttc gtcgacggtg gcgtccaccc ccggttcggg       120
     acccgcaaca tgatcctgcc gctcgccggc aacacctacc tcgaggtggt cgaggtgctc       180
     gaccacccgg cctccgacaa ggccccgttc ggccaggccg tgcgcgcccg ttccgccctc       240
     ggcggcggct ggctcggctg ggtcgtcgcg gtcgacgaca tcaccgtggt cgagcggcgc       300
     ctcggccggg aggccgtcgt cggcagccgg caccgccccg acggcaccga gctgcggtgg       360
     aagcagatcg gcgtcaacgg gttgatcgcc gacccgcagc tgcccttctt catcgagtgg       420
     gagatcccgg ccgagctgca ccccagcgcc ggcgccgacg aggcgttctc ccttgcctgc       480
     ctggagatcg cgggcgaccc gcaccgggtg agcgagtggc tcggcgagac cgtcgaggca       540
     ccactggagg acgtgaaggt cgagtgggcc gcgcccaacg gcacgcccgg catcggcgcc       600
     gcgcagttcc agaccccgag cggcctggtc cggctgtag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page