(data stored in ACNUC1104 zone)

EMBL: CP000509.PE466

CP000509.PE466       Location/Qualifiers
FT   CDS_pept        complement(505707..506477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3349 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80016"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY1"
FT                   /protein_id="ABL80016.1"
FT                   /translation="MPEVDLVFPRAYVEFVNPADETEVLRCDLTWLTSSYTCIFGRGCP
FT                   GIYADAPDVGCCTLGAHFADKDDEKRVAEYVGMLDEELWQHKPQRPDGKVRKRDWIELD
FT                   DEGERKTRTIEVDGQQACIFQNRPDFKNGAGCALHALAYVLDKLPLETKPDVCWQLPIR
FT                   RTFRDVTRQDGSTYTEVSIGEYDRRGWGPGGHDLDWYCSGNTEAHVGVEPVYVANAAEL
FT                   TALMGEAAYAELVRHCEAHVRSRSALALHPADPH"
     gtgcccgaag tcgatctggt cttcccccgc gcctacgtgg agttcgtgaa ccctgccgac        60
     gagaccgagg tgctgcgctg cgacctcacc tggctgacct cgagctacac ctgcatcttc       120
     gggcgggggt gcccgggcat ctacgccgat gccccggacg tcgggtgctg cacgctcggc       180
     gcacacttcg ccgacaagga cgacgagaaa cgggtcgcgg agtacgtcgg gatgctcgac       240
     gaggagctgt ggcagcacaa gccgcagcgg cccgacggca aggtccgcaa gcgggactgg       300
     atcgagctcg acgacgaggg cgagcgcaag acccgcacga tcgaggtcga cgggcagcag       360
     gcgtgcatct tccagaaccg cccggacttc aagaacggag ccggctgcgc cctgcacgcg       420
     ctggcctacg tgctcgacaa gttgccgctc gagaccaagc cggacgtgtg ctggcagctg       480
     ccgatccggc gcaccttccg cgacgtcacc cgccaggacg gctcgacgta caccgaggtc       540
     tcgatcggcg agtacgaccg gcgcggctgg ggtccgggcg ggcacgacct cgactggtac       600
     tgctcgggca acaccgaggc gcacgtcggc gtggagccgg tgtacgtcgc gaacgccgcc       660
     gagctgaccg ccctgatggg cgaggcggcg tacgccgagc tggtccggca ttgcgaggcg       720
     cacgtgcggt cccggtcggc gctcgcgctg cacccggccg acccgcactg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page