(data stored in ACNUC1104 zone)

EMBL: CP000509.PE468

CP000509.PE468       Location/Qualifiers
FT   CDS_pept        507474..508262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0476"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sco:SCO3347 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80018"
FT                   /db_xref="GOA:A1SDY3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY3"
FT                   /protein_id="ABL80018.1"
FT                   /translation="MAPRVGLSTVSVYPESSAHAFAYASALGYDTIEVMVGIDALSQQT
FT                   SAIQQLSAHHGVPVSAVHAPCLLFTQRVWGTEPWGKLERSAEMAAALGAEVVVVHPPFR
FT                   WQKSYARDFVDGIAALEESTGIAFAVENMYPWRASSRGMEMYLPGWDPSSEPYANTTID
FT                   LSHAAIARSDPVGMAERLGDRLRHIHLTDGTGSAKDEHLVPGRGSIGAAAFLRHLAAAG
FT                   FGGEIVVEINTRKCRDAAAREVDLRESLEFAREHSVVGTP"
     atggccccac gcgtcggact ctccaccgtc tcggtctacc ccgagtcctc cgcccatgcc        60
     ttcgcctacg cgagtgcgct cggttacgac accatcgagg tgatggtcgg gatcgacgcg       120
     ctcagccagc agacctccgc gatccagcag ctctccgcac accacggcgt accggtgtcc       180
     gcggtgcacg cgccctgcct gctgttcacg cagcgggtct ggggcaccga gccgtggggc       240
     aagctcgagc gctccgcgga gatggcggcg gcgctcgggg ccgaggtcgt cgtggtccat       300
     ccgccgttcc gctggcagaa gagctatgcc cgcgacttcg tggacggcat cgccgcgctc       360
     gaggagtcca ccggcatcgc gttcgcggtg gagaacatgt atccctggcg tgcctccagc       420
     cgcggcatgg agatgtacct gcccggctgg gacccctctt ccgagccgta cgccaacacc       480
     accatcgacc tctcccacgc ggccatcgcg cggtccgacc cggtcgggat ggccgagcgt       540
     ctcggcgacc ggttgcggca catccacctg accgacggca ccggctcggc caaggacgag       600
     cacctggtcc ccggtcgggg atcgatcggc gccgccgcgt tcctgcggca cctggcggcg       660
     gccgggttcg gtggtgagat cgtcgtcgag atcaacaccc gcaagtgccg cgacgccgcg       720
     gcccgcgagg tcgacctgcg cgagtccctc gagttcgcgc gcgagcactc cgtcgtgggg       780
     acgccgtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page