(data stored in ACNUC1104 zone)

EMBL: CP000509.PE470

CP000509.PE470       Location/Qualifiers
FT   CDS_pept        508897..509646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0478"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nfa:nfa19890 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80020"
FT                   /db_xref="GOA:A1SDY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY5"
FT                   /protein_id="ABL80020.1"
FT                   /translation="MPGGASVRIIQRMVKNAVEIRDLHVVRGPHTVLEHLDLTIGGGVT
FT                   GLLGPSGCGKSTLMRCLVGVQRIRGGTVEVFGLPAGSRPLRDRVGYVTQAVSVYHDLTV
FT                   AENLHFFARVLGAGRAEVDRAITAVDLADHRDDVVGRLSGGQQSRASLAVALLDEPDLL
FT                   VLDEPTVGLDPVLREDLWNLFHRLADAGVAVFVSSHVMDEAERCDRLLLMRQGRILADG
FT                   TPAEIKAAAGVDDVEAAFLALVRRDAA"
     ttgccgggtg gggcctccgt acgcataatt caacgcatgg tgaaaaacgc ggtggagatc        60
     cgcgacctcc acgtcgtccg gggtccgcac accgtcctcg agcacctcga cctgacgatc       120
     gggggcgggg tcaccgggct gctcggcccg tccgggtgcg gcaagtcgac gctgatgcgc       180
     tgcctggtcg gcgtacaacg gatccgcggc gggaccgtcg aggtcttcgg cctgccggcg       240
     ggcagccgcc cgctccggga ccgggtcggc tacgtcaccc aggcggtcag cgtctaccac       300
     gacctgaccg tcgccgagaa cctgcacttc ttcgcgcggg tgctgggcgc gggccgcgcc       360
     gaggtcgacc gggcgatcac cgccgtggac ctggccgacc accgcgacga cgtcgtcgga       420
     cggctcagcg gtgggcagca gtcgcgcgcg agcctggcgg tcgcgctgct ggacgagccg       480
     gacctgctgg tgctcgacga gccgacggtg ggactcgacc cggtgctccg cgaggacctg       540
     tggaacctct tccaccgcct ggccgacgcc ggtgtcgccg tcttcgtctc cagccacgtc       600
     atggacgagg ccgagcgctg cgaccggctg ctgctgatgc ggcagggccg gatcctcgcc       660
     gacgggacgc ccgccgagat caaggccgcg gccggcgtcg acgacgtcga ggccgcgttc       720
     ctcgcgctgg tcaggaggga cgcggcatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page