(data stored in SCRATCH zone)

EMBL: CP000509.PE473

CP000509.PE473       Location/Qualifiers
FT   CDS_pept        511592..512395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0481"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: sma:SAV4724 putative pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80023"
FT                   /db_xref="GOA:A1SDY8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY8"
FT                   /protein_id="ABL80023.1"
FT                   /translation="MSQTAILGAGVMGETLLSGLVRAGRRVDHLLVGEKRPERAQELEE
FT                   RYGVAVVGNAEAARKADTLALVVKPQDMGDLLEEIAGELRPGQLVVSLAAGITTAFIEA
FT                   RVPEGVAVVRVMPNTPALVDEGMAAVSPGSHCSEEHLAEAESLMASVGRVLRIPERQQD
FT                   AVTAISGSGPAYIFFVVESMIEAGVHLGLPRATATDLVVQTVVGSAKMLRETGTHPAVL
FT                   REQVTSPAGTTAAALRELEIHKVRAAFLAAMEAARDRSRALAEGS"
     atgtcccaga ccgccatcct cggcgccggc gtgatgggcg agaccctgct ctccggcctg        60
     gtgcgcgccg gccgccgcgt cgaccacctg ctggtcggcg agaagcgccc cgagcgcgcc       120
     caggagctcg aggagcggta cggcgtcgcc gtggtcggca acgccgaggc ggcccgcaag       180
     gccgacacgc tcgccctggt cgtcaagccc caggacatgg gcgacctgct cgaggagatc       240
     gccggcgagc tgcgcccggg ccagctggtc gtctcccttg cggccggcat caccaccgcc       300
     ttcatcgagg cccgggtccc cgagggcgtc gccgtggtcc gggtgatgcc gaacacgccc       360
     gcgctggtcg acgaggggat ggctgcggtc tctcccgggt cgcactgcag cgaggagcac       420
     ctcgccgagg ccgagtcgct gatggcgtcg gtcggccggg tgctccggat cccggagcgc       480
     cagcaggacg ccgtcaccgc gatctccggg tccggcccgg cctacatctt cttcgtcgtg       540
     gagtcgatga tcgaggccgg cgtccacctg ggcctgccgc gtgcgaccgc caccgacctg       600
     gtcgtccaga ccgtcgtggg ctcggccaag atgctgcgcg agaccggcac ccacccggcc       660
     gtgctgcgcg agcaggtcac ctccccggcc ggcaccaccg cggcggccct gcgcgagctg       720
     gagatccaca aggtgcgcgc cgcgttcctc gccgccatgg aggccgcgcg cgaccggtcg       780
     cgtgcgctcg ccgagggcag ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page