(data stored in ACNUC1104 zone)

EMBL: CP000509.PE48

CP000509.PE48        Location/Qualifiers
FT   CDS_pept        complement(54476..55060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0048"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; KEGG: sco:SCO1410
FT                   GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79598"
FT                   /db_xref="GOA:A1SCR3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR3"
FT                   /protein_id="ABL79598.1"
FT                   /translation="MFGFWRYLSSSAHDVSRNTLREAFRLLVHERLLVHELNRGVFVRE
FT                   ASLDEVADLFRLRRVLECSSVRTPEPPEAAVARLRSAVSEGETAAREGQWQEVGTANMH
FT                   FHLAVGALAGSPRIDELMEQLMAELRLVFHVMAAPQKFHAPYLEDNARICALVQAGRGE
FT                   EAAALLDTYLARAERQLVQAYRLVAHATASA"
     atgttcggat tctggcgcta cctcagttcc agcgcacacg acgtctcccg caacacgctg        60
     cgcgaggcgt tccgcctcct cgtgcacgag cggctgctcg tgcacgagct caaccggggc       120
     gtcttcgtcc gggaggcgtc gctcgacgag gtcgccgacc tgttccggtt gcgccgggtg       180
     ctcgagtgct cctcggtccg caccccggaa ccgcccgagg ccgcggtggc gcggctccgg       240
     tcggcggtgt ccgagggcga gacggccgcc cgtgagggcc agtggcagga ggtcggcacc       300
     gccaacatgc acttccacct cgcggtgggg gccctcgccg ggagcccccg gatcgacgag       360
     ttgatggagc agctgatggc ggagctgcgc ctggtcttcc acgtgatggc ggcgccccag       420
     aagttccacg cgccctacct cgaggacaac gcccggatct gcgccctcgt ccaggccggc       480
     cgcggcgagg aggccgcggc gctgctcgac acctacctgg cgcgcgccga gcggcagctg       540
     gtccaggcgt accggctcgt cgcccacgcg acggccagcg cgtag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page