(data stored in ACNUC1104 zone)

EMBL: CP000509.PE480

CP000509.PE480       Location/Qualifiers
FT   CDS_pept        complement(517793..518947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV4734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80030"
FT                   /db_xref="GOA:A1SDZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ5"
FT                   /protein_id="ABL80030.1"
FT                   /translation="MTWGFTAQRRAEEFDARVEGASTYDVADPRDAELLALVGALRAVP
FT                   EAQPRPEFVATLRERLMAEAATALVPDDVSRLTLPARRPTRERRLAAVVGGIVIVGAST
FT                   SLAVASQSALPGDSLYPVKRAIEQAHTGLSVGEGSKGTTILANASDRLDEVDALTRQNH
FT                   FGDEIRIADTLNTFTDQATQATDLLLADYAHTGEASSIAHLRDFAASSLTRLADLEPLV
FT                   PAEARDELIRAAGVVTTIDTEAALRCGDCGGAGITSIPATLGAAAEVINVPKPPADAVT
FT                   KGDRTRNGGKHGTKGAQGTGLPDVDPGEVGPGSILNPDGSGLQPGTTTSGGSDPIGDLA
FT                   NGLTGGDSPSDAPSVPVVTDVVDGVGGILQDVVDGVTGGLPKTP"
     atgacctggg gtttcacggc gcagcgccgc gccgaggagt tcgacgcgcg agtggagggc        60
     gcgtcgacgt acgacgtcgc cgacccgcgg gacgccgagc tgctcgcgct cgtcggtgcc       120
     ctgcgcgcgg tgcccgaggc ccagccgcga cccgagttcg tcgccactct ccgcgagcgg       180
     ctgatggccg aggccgcgac cgcgctcgtc cccgacgacg tctccaggct gacccttccg       240
     gcgcgtcgtc ccacgcgcga gcgtcggctg gccgccgtgg tcggcggcat cgtgatcgtc       300
     ggcgccagca cttcgctcgc ggtcgcctcc cagtccgctc ttccgggcga ctcgctctac       360
     ccggtcaagc gtgccatcga gcaggcccac accgggctca gcgtcggcga gggcagcaag       420
     ggcaccacca tcctcgcgaa cgcctccgac cgtctcgacg aggtcgacgc gctcacccgc       480
     cagaaccact tcggcgacga gatccggatc gcggacacgc tcaacacctt caccgaccag       540
     gcgacccagg ccaccgacct gctgctggcc gactacgccc acaccggcga ggcctcctcg       600
     atcgctcacc tgcgcgactt cgccgcctcg agcctcaccc gcctcgccga cctcgagcca       660
     ctggtgccgg ccgaggcccg cgacgagctg atccgcgcgg ccggcgtcgt caccacgatc       720
     gacaccgagg ccgcgctgcg ctgcggtgac tgcggcggcg cgggcatcac ctccatcccg       780
     gcgacgctcg gggcggccgc cgaggtcatc aacgtgccca agccgcccgc cgacgcggtc       840
     accaagggcg accgcacccg caacggcggc aagcacggca ccaagggcgc ccagggcacc       900
     ggcctccccg acgtggaccc cggcgaggtc ggccccggca gcatcttgaa ccccgacggc       960
     agcggcctcc agcccggcac caccaccagc ggcggctccg acccgatcgg cgacctggcg      1020
     aacgggctca ccggcggcga ctcccccagc gatgcgccgt cggtccccgt ggtcaccgat      1080
     gtcgtcgacg gtgtcggcgg catcctccaa gacgtcgtcg acggcgtcac cggcgggctg      1140
     ccgaagactc cctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page