(data stored in ACNUC1104 zone)

EMBL: CP000509.PE481

CP000509.PE481       Location/Qualifiers
FT   CDS_pept        complement(519078..519878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0489"
FT                   /product="sigma-70 region 2 domain protein"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sma:SAV4735 RNA polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80031"
FT                   /db_xref="GOA:A1SDZ6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ6"
FT                   /protein_id="ABL80031.1"
FT                   /translation="MSWEDTDVARGLDALRRLVAHVLVLEQPQLAGTPGMLATEAVASG
FT                   RAEMRAKTRPKSGPGTGDGGPDGYGDAELATSSEEDEAERSRLIALVELARKGDADAFG
FT                   LLYDHYQPSVYRFLFYRTRSGTLAEDLTSETFFRALRSMNNFRWQGKDFGAWLMTIARN
FT                   LATDHFKAGRTRLELTTEDMGLHDDATEGPESMVLAGLTNELLLHALTELPPEQRDCLV
FT                   MRFLQGMSIAETAAVLGRSDGAVKQLQLRGVRNLAKLMPEGIRD"
     atgtcgtggg aggacaccga cgtcgcgcgc ggtctcgacg cgctgcgacg cctcgtggcc        60
     cacgtgcttg tcctggagca gccccagctc gccgggacac ccgggatgct cgccaccgag       120
     gcggtcgcca gcgggcgcgc ggagatgcgc gcgaagaccc gccccaagag cggccccggg       180
     accggcgacg gcggtcccga cgggtacggc gacgcggagc tcgccacctc ctcggaggag       240
     gacgaggccg agcggagccg gctgatcgcg ctggtggagc tggcccgcaa gggcgacgcc       300
     gacgccttcg gcctcctcta cgaccactac cagccctcgg tctaccgctt cctcttctac       360
     cggacccggt ccggcaccct cgccgaggac ctgacctccg agaccttctt ccgcgcgttg       420
     cggagcatga acaacttccg ctggcagggc aaggacttcg gcgcctggct gatgacgatc       480
     gcccgcaacc tcgcgaccga ccacttcaag gccggccgga cccgcctcga gctcaccacc       540
     gaggacatgg gcctgcacga cgacgcgacc gagggcccgg agtcgatggt gctcgccggg       600
     ctcaccaacg agctgctgct gcacgccctg accgagctgc cgcccgagca gcgcgactgc       660
     ctggtgatgc ggttcctcca ggggatgagc atcgccgaga cggcggccgt cctgggccgc       720
     agcgacgggg ccgtcaagca gctccagctg cgtggggtgc gcaacctcgc gaagctgatg       780
     cccgagggga tccgggactg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page