(data stored in SCRATCH zone)

EMBL: CP000509.PE482

CP000509.PE482       Location/Qualifiers
FT   CDS_pept        complement(520088..520981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0490"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV4736 3-phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80032"
FT                   /db_xref="GOA:A1SDZ7"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ7"
FT                   /protein_id="ABL80032.1"
FT                   /translation="MTPAHDRRARPRNLQLRSVLAGEAAAAAAEVESALTPPLDPVAAA
FT                   FFDVDNTVMQGASIFHLARGLHRRKFFTTREILGAAWKQAYFRVVGVEDPAHVADARAS
FT                   ALGFIAGHTVTELQDLGEEIFEEAMADRIWPGTRALAQLHLDEGQRVWLVTAAPIEIAQ
FT                   IIARRLGLTGALGTVAEHIDGVYTGRLVGDLLHGPAKGEAVRALAAREGLDLHRCSAYS
FT                   DSFNDLPMLTMVGDPCAINPDARLRAHAREQGWRIHDYRTGRKALRAGLVAGGIAGAAS
FT                   GTVAAGLALRGRRFPR"
     gtgaccccgg cgcacgacag gcgagcccgc ccgcggaacc tccagctgcg gtccgtgctc        60
     gccggcgagg ccgccgcggc ggccgccgag gtggagtccg cgctcacccc gccgctcgac       120
     ccggtcgccg cggccttctt cgacgtcgac aacaccgtga tgcagggggc gagcatcttc       180
     cacctcgccc gcggcctgca ccgccgcaag ttcttcacca cccgcgagat cctcggggcc       240
     gcctggaagc aggcctactt ccgggtcgtg ggcgtcgagg accccgccca cgtggccgac       300
     gctcgggcct ccgccctcgg gttcatcgcc ggacacaccg tcacggagct ccaggacctc       360
     ggcgaggaga tcttcgagga ggcgatggcg gaccggatct ggccgggcac ccgcgccctg       420
     gcgcagctgc acctcgacga gggccagcgg gtctggctgg tcaccgccgc gccgatcgag       480
     atcgcgcaga tcatcgcgcg ccgactcggc ctcaccggcg cgctcggcac ggtcgccgag       540
     cacatcgacg gcgtctacac cggccggctc gtcggcgacc tgctgcacgg gccagcgaag       600
     ggcgaggccg tccgtgccct cgccgcccgc gagggtctcg acctgcatcg ctgctcggcg       660
     tactccgact ccttcaacga cctgccgatg ctgaccatgg tcggcgaccc gtgcgccatc       720
     aacccggacg cccggctccg ggcccacgcc cgggagcagg gctggcggat ccacgactac       780
     cgcaccgggc gcaaggcgct gcgcgccggc ctggtcgcgg gcggcatcgc cggcgccgcc       840
     agcggcacgg tcgccgccgg cctggcgctc cgcggccggc ggtttccccg gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page