(data stored in ACNUC1104 zone)

EMBL: CP000509.PE485

CP000509.PE485       Location/Qualifiers
FT   CDS_pept        523011..523688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0493"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sma:SAV4738 putative AT-rich
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80035"
FT                   /db_xref="GOA:A1SE00"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE00"
FT                   /protein_id="ABL80035.1"
FT                   /translation="METRSVSARTSPESARDIPEATVARLPVYLRALVTLSEQGTATCS
FT                   SEELAVAAGVNSAKLRKDLSYLGSYGTRGVGYDVDYLRYQIAREIGVTQDWPVVIVGIG
FT                   NLGQALANYSGFRSRGFRVVALLDADPARHDQVVAGIEVRPFDHLERIVRDHAVAIGVI
FT                   ATPAVAAQDVADRMVAYGITSILNFAPTVLTVPAEVDVRKVDLSIELQILAYHEQRKGA
FT                   VTA"
     ttggagacga gatcagtgag cgcacggacc tcccccgaga gtgcccggga catccccgag        60
     gcgaccgtcg cgcgactccc cgtctacctc cgggcgctgg tgacgctgtc cgagcagggc       120
     accgccacct gctcgagcga ggagctcgcg gtcgccgcgg gcgtcaacag cgcgaagctg       180
     cgcaaggacc tgtcctacct cggcagctac ggcacccgcg gggtcggcta cgacgtggac       240
     tacctgcgct accagatcgc ccgcgagatc ggggtcaccc aggactggcc ggtcgtcatc       300
     gtcggcatcg gcaacctcgg gcaggcgctc gcgaactact ccggcttccg cagccgcggg       360
     ttccgcgtgg tcgcgctgct cgacgccgac ccggcgcgcc acgaccaggt ggtcgcgggt       420
     atcgaggtac gccccttcga ccacctcgag cggatcgtcc gcgaccacgc cgtcgcgatc       480
     ggcgtgatcg cgaccccggc cgtggccgcc caggacgtgg ccgaccggat ggtcgcctac       540
     gggatcacca gcatcttgaa cttcgccccg accgtgctga ccgtgcccgc ggaggtcgac       600
     gtgcgcaagg tcgacctgtc catcgagctg cagatcctcg cctaccacga gcagcgcaag       660
     ggtgcggtga cagcgtga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page