(data stored in ACNUC1104 zone)

EMBL: CP000509.PE49

CP000509.PE49        Location/Qualifiers
FT   CDS_pept        56595..58040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0050"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; KEGG:
FT                   rpc:RPC_1956 Tat-translocated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79599"
FT                   /db_xref="GOA:A1SCR4"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR4"
FT                   /protein_id="ABL79599.1"
FT                   /translation="MTEQHHNPTELTASTPGAARHARGVVPFQPDDPVMKSPYAHGAFV
FT                   FATLPAEWDTPAVTTWLTTIDTARQALRAACTPDVVRVATIAVGFGPSFFYRPDATVRF
FT                   AGVTPPAGFAQLPPMPHGAAVPADVCFYIVAIAEAEIAKFVNALAASGVTGLAMEHGYK
FT                   SYPDEEAFGYRDGVRNIPVSSRNDFVFIDADRNAEEPDWTHHGTYMAYMRIAQNLAAFQ
FT                   AIPAAEQDQVIGRDRTGRRLDLPEGTKAKDEPSFATDDPRLDSHVRKVGPRGFEHRDET
FT                   QIFRRGLPFFEVRDGQVVQGLQFASFQASLDQFDAVFNRWMLNPDFPRSGTGVDALVAR
FT                   GLITIEKWGFYFVPPDTDGPIGMGMFAPAKETRKPKTGRVAVRKELVDANGTRVNGDLG
FT                   GFTFQITDLEGNPVGESFTSNSHGHALSGEIPLGDYQLTELPPQPPQPPMPAAGPVSFT
FT                   LRSAQEVVKVRNQLTPAAGPYNG"
     atgaccgagc agcaccacaa ccccaccgaa ctcaccgcca gcacccctgg tgcggccaga        60
     catgcccgcg gggtcgtccc cttccagccg gacgaccccg tcatgaagtc gccctacgcc       120
     cacggcgcat tcgtcttcgc gacccttccc gccgagtggg acacccccgc cgtgaccacc       180
     tggctcacca ccatcgacac cgcccgacag gccctgcgtg ctgcgtgcac tcctgacgtg       240
     gttcgcgtcg cgacgatcgc cgtggggttc gggccttcgt tcttctatcg gcccgacgcc       300
     actgtgcgct tcgccggggt gactccgccg gcgggattcg ctcagctgcc tccgatgccg       360
     cacggcgcgg cggtgccggc cgacgtgtgc ttctacatcg tggcgatcgc cgaggcagag       420
     atcgccaagt tcgtcaacgc gctcgcggcc agcggcgtca ccggcctggc gatggagcac       480
     ggctacaagt cctatccgga cgaggaggcg ttcgggtacc gagacggggt ccgcaacatc       540
     cccgtgtcct cgcgcaacga tttcgtgttc attgacgccg accgcaacgc cgaggagccg       600
     gactggaccc accacggcac ctacatggcc tacatgcgca tcgcccagaa cctggccgcg       660
     ttccaggcga tcccggccgc cgagcaggac caggtcatcg gccgggaccg gacgggccgc       720
     cgcctcgacc tccccgaggg caccaaagca aaggacgagc cgtccttcgc taccgacgac       780
     ccgcgcctgg actcccacgt ccgcaaggtc ggtccgcgcg ggttcgagca ccgcgacgag       840
     acccagatct tccgtcgcgg cctgccgttc ttcgaggtgc gcgacggcca ggtcgtccag       900
     gggctgcagt tcgcctcctt ccaggcctcg ctcgaccagt tcgacgcggt gttcaaccgg       960
     tggatgctca accccgactt cccgcggtcc gggacagggg tcgacgcact cgtggcgcgc      1020
     ggcctgatca cgatcgagaa gtggggtttc tacttcgtgc ctcccgacac cgacggcccc      1080
     atcgggatgg gcatgttcgc gcccgccaag gagacgcgga agccgaagac gggcagagtg      1140
     gcggtccgca aagagctggt cgacgcgaac gggacacgcg tcaacggcga cctgggcggc      1200
     ttcaccttcc agatcaccga cctggagggc aacccggtcg gagagtcgtt cacttcaaac      1260
     tcgcatggcc acgcgctgtc gggcgagatc ccgctcggcg actaccagct gaccgagctg      1320
     ccccctcagc ccccgcagcc gccgatgcca gcggccgggc cggtgtcgtt cactctccgc      1380
     tccgcccagg aggtcgtgaa ggtccgcaac cagctcaccc ccgccgccgg accgtacaac      1440
     ggctga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page