(data stored in ACNUC1104 zone)

EMBL: CP000509.PE493

CP000509.PE493       Location/Qualifiers
FT   CDS_pept        532363..532965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0501"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pac:PPA0325
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80043"
FT                   /db_xref="GOA:A1SE08"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE08"
FT                   /protein_id="ABL80043.1"
FT                   /translation="MTRLRRSLGAGAVGLLLLTGCSSLEGTGDKGYISGDQRVRVVDPA
FT                   DRGSAVELTGTSLTGDPVDVADSRGRVLVVNTWWSGCAPCRSEMPMLTAAAKELGERAD
FT                   FLGINIRDASASQGQAFIRSVGAEYPSIYDPTGKAVLAFAGKTTLSAIPTTIVLDAEGR
FT                   VAAVITGEIPSKQTLVDVVDEVAANAAAESGGETADG"
     atgacccgtc tccggcgcag cttgggagcg ggggccgtcg gcctgttgct cctcaccggg        60
     tgctcctcgc tggagggcac cggcgacaag ggctacatca gcggcgatca gcgggtgcgc       120
     gtcgtcgacc cggccgaccg cgggtcggcc gtcgagctca cgggcacctc cctgaccggc       180
     gacccggtgg acgtcgccga ctcccggggt cgggtcctgg tggtcaacac ctggtggtcg       240
     ggctgcgccc cgtgccgcag cgagatgccg atgctgaccg ccgccgcgaa ggaactgggc       300
     gagcgggccg acttcctcgg catcaacatc cgcgacgcca gcgccagcca ggggcaggcg       360
     ttcatacgca gcgtgggcgc ggagtacccg tcgatctacg acccgaccgg caaggcggtc       420
     ctcgcgttcg cagggaagac caccctgtcg gcgatcccga ccacgatcgt gctcgacgcc       480
     gaaggccggg tcgccgccgt catcaccggg gagatcccct cgaagcagac cctggtcgac       540
     gtcgtcgacg aggtcgctgc caacgccgcc gcggagtcgg gcggggagac cgcggatggg       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page