(data stored in ACNUC1104 zone)

EMBL: CP000509.PE494

CP000509.PE494       Location/Qualifiers
FT   CDS_pept        532958..533719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0502"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: sco:SCO4473 putative cytochrome biogenesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80044"
FT                   /db_xref="GOA:A1SE09"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE09"
FT                   /protein_id="ABL80044.1"
FT                   /translation="MGDWFQQTAFSGSLVLAVPVALIAGLVSFFSPCVIPLLPGYLSYA
FT                   TGLSGADLATGAAGTRRGRMLLGSVLFVLGFSVVFVALGTLSGALGSWLVTWRDQMTFV
FT                   LGLLTIVLGLAFAGWLPFFRRDWRVHSVPAVGLAAAPLLGFLFGLGWTPCIGPTLSAIT
FT                   TLSFTESTAGRGAVLSAVYALGLGLPFVLAGLAYEKALATVGWVRRHQAWVMRAGGLML
FT                   VAVGLMLVTGWWDQAVTWIQLHLVSSSETAL"
     atgggtgact ggttccagca gaccgcgttc tccgggtcgc tcgtcctcgc cgtgccggtg        60
     gccctgatcg ccggcctggt gtccttcttc tccccgtgcg tgatcccgct cctgcccggc       120
     tacctctcct acgcgaccgg cctctccggc gccgacctcg ccaccggcgc ggccggcacc       180
     cggcgcggcc ggatgctact cggctcggtc ctgttcgtgc tgggcttctc ggtggtcttc       240
     gtcgccctcg gcaccctctc cggggcgctc gggtcgtggc tggtcacctg gcgcgaccag       300
     atgacgttcg tgctcgggct gctgacgatc gtgctcgggc tggccttcgc cggctggctg       360
     ccgttcttcc ggcgcgactg gcgggtgcac tcggtgccgg cggtcggcct cgccgccgcg       420
     ccgctgctcg gcttcctgtt cgggctcggc tggacgccgt gcatcgggcc cactctgagc       480
     gcgatcacca cgctctcctt caccgagtcg accgccggcc gcggtgccgt gctctcggcc       540
     gtctacgccc tcggcctcgg cctgcccttc gtcctcgccg gcctcgccta cgagaaggcg       600
     ctcgcaaccg tcggctgggt acgccgccac caggcctggg tgatgcgcgc cggcgggctg       660
     atgctggtgg ccgtcggcct gatgctggtg accggctggt gggaccaggc cgtcacctgg       720
     atccagctgc acctggtgag ctcctcggag accgcgctat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page