(data stored in SCRATCH zone)

EMBL: CP000509.PE495

CP000509.PE495       Location/Qualifiers
FT   CDS_pept        533802..535400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0503"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: sco:SCO4474
FT                   putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80045"
FT                   /db_xref="GOA:A1SE10"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE10"
FT                   /protein_id="ABL80045.1"
FT                   /translation="MSTPTRTSLSTRPPEDDRRPGELTLRELLRWTWRQLTSMRTALVL
FT                   LLLLALAAVPGSIIPQEGVDSLKTSNWRSDHPKLTPVYERLGLFSVYDSPWFSAIYLLL
FT                   MVSLVGCIIPRAILYWRGMWAQPPAAPRNLTRLPDHATYQTAVAPDAVLERARATLRRR
FT                   RYRLSPEAGDAVAAERGYLREAGNLLFHLAVVVVLVGFALGGLFGYKGGVILLVGDGYG
FT                   FSNNLTQYDDFDPGSLFRDSDMEPFSFSIDDFSVEWLTSGPRAGMARGFESHLTYRESP
FT                   DAPDRTYDLKVNHPLSIGNTDVFLIGHGYAPVLTIRDGDGEEVYSGPTIFLPTDQSFQS
FT                   IGVVKAPDAEPTQIGLEGEFYPTVAFSKQTGSYFSLFGRPLDPLVSMLVYTGDLGMDDG
FT                   QPQSVYSLDKSRTTMLTKANGAPYRIDLRPGEQVTLPDGLGTVSFDGLERWNKIQISQT
FT                   PGKWIALIGVVLALLGLLGSLFIRPRRVWVRARRDGDGTLVEVAALDRSGGGDVAVVVA
FT                   QLVTDLQQPDREDNS"
     atgagcaccc cgacccgcac gtcgctgagc acccggccgc ccgaggacga ccggcgcccc        60
     ggtgagctga cgctccgcga gctgctgcgc tggacctggc gccagctcac ctcgatgcgc       120
     accgcgctgg tcctgctgct gctcctggcg ctcgcggccg tcccgggctc gatcatcccg       180
     caggagggcg tcgactccct caagacctcg aactggcggt ccgaccaccc gaagctgacg       240
     ccggtctacg agcggctcgg gctgttctcc gtctacgact cgccctggtt ctcggcgatc       300
     tacctgctgc tgatggtctc gctggtgggc tgcatcatcc cgcgcgcgat cctctactgg       360
     cgcgggatgt gggcccagcc cccggcggcc ccccgcaacc tgacccggct gccggaccac       420
     gcgacgtacc agaccgccgt cgcacccgac gccgtgctcg agcgcgcccg ggcgaccctg       480
     cgccgacggc gctaccgcct ctcgcccgag gccggcgacg cggtggccgc cgagcgcggc       540
     tacctgcgcg aggccggcaa cctgctcttc cacctggccg tggtcgtggt gctggtcggc       600
     ttcgcgctcg gcgggctgtt cggctacaag ggcggcgtga tcctgctggt cggcgacggc       660
     tacgggttct ccaacaacct gacgcagtac gacgacttcg accccggaag cctgttccgg       720
     gacagcgaca tggagccctt ctcgttctcg atcgacgact tcagcgtcga gtggctcacc       780
     tccggcccac gggcggggat ggcgcgcggg ttcgagtcgc acctgaccta ccgcgagtcg       840
     ccggacgcgc cggaccggac ctacgacctc aaggtcaacc acccgctgag catcggcaac       900
     accgacgtct tcctcatcgg ccacggctac gcgccggtgc tcacgatccg ggacggcgac       960
     ggcgaggagg tctacagcgg tccgacgatc ttcctgccga ccgaccagag cttccagtcc      1020
     atcggggtcg tcaaggcgcc ggacgccgag ccgacgcaga tcgggctcga gggcgagttc      1080
     tacccgaccg tcgcgttctc gaagcagacc ggcagctact tctcgctgtt cggtcgcccg      1140
     ctggacccgc tggtctcgat gctcgtctac accggtgacc tcggcatgga cgacggccag      1200
     ccgcagtcgg tctactccct ggacaagtcc aggacgacga tgctgaccaa ggccaacggc      1260
     gcgccgtacc gcatcgacct gcgccccggc gagcaggtga ctctccccga cggcctcggc      1320
     accgtcagct tcgacggcct cgagcgctgg aacaagatcc agatcagcca gacgccgggc      1380
     aagtggatcg ccctgatcgg cgtcgtgctg gcgctgctgg gcctgctcgg ctcgctgttc      1440
     atccgtccac gacgcgtctg ggttcgcgcc cgtcgtgacg gggacggcac actggtcgag      1500
     gtcgccgcgc tcgaccggtc cggcggtggc gacgtcgccg tcgtcgtcgc ccagctcgtg      1560
     accgacctgc aacaacccga ccgggaggac aactcgtga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page