(data stored in ACNUC1104 zone)

EMBL: CP000509.PE496

CP000509.PE496       Location/Qualifiers
FT   CDS_pept        535397..536422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0504"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   pac:PPA0328 putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80046"
FT                   /db_xref="GOA:A1SE11"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE11"
FT                   /protein_id="ABL80046.1"
FT                   /translation="MTDVQWESLSNWAVAASGVVYFLALLVHLAEWASLRKVPVAAGAA
FT                   VTSSVDIPGGIAVATGPGGEGDGQDEGKVRRTEFLGRLGYLLTVLAVAVQLVALVGRGM
FT                   AADPDRVPWGNMYEFTLTGTFVVAALYVALYHKLRLAWMAPIVVAFVLSVLMVAVIWLY
FT                   APVAPLTEALSSYWLVIHVVSAIIATGAFTLGGITSALYLVKARAPERESGYVARLPRP
FT                   EVLDRVSYRLHAFGFPVWTFAVLITGPIWAHQAWSSYWNWDPKEVWAFITWVVYAAYLH
FT                   ARTTAGWKGRNAAILALVGVATLWFNFIGINYFSTTSQHSYAGGAPALVEPAAPQSDAL
FT                   G"
     gtgaccgacg tgcagtggga gagcctgagc aactgggcgg tggccgccag cggggtcgtg        60
     tacttcctcg cgctgctggt gcacctcgcc gagtgggcgt ccttgcgcaa ggtcccggtc       120
     gcggccggtg ccgcggtgac gtcctcggtg gacatcccgg gtgggatcgc cgtggccacc       180
     ggtcccggcg gcgagggcga cggccaggac gaggggaagg tgcggcgcac cgagttcctc       240
     ggccgcctgg gctacctgct caccgtcctc gcggtggccg tccagctcgt ggcgctcgtg       300
     gggcgcggca tggccgccga cccggaccgg gtgccgtggg gcaacatgta cgagttcacc       360
     ctcacgggga ccttcgtggt cgccgcgctg tacgtcgcgc tctaccacaa gctgcggctc       420
     gcctggatgg cgccgatcgt ggtcgctttc gtgctcagcg tgctgatggt cgcggtgatc       480
     tggctctacg cccccgtcgc cccgctgacc gaggcgctct cgtcgtactg gctggtgatc       540
     cacgtggtct ccgcgatcat cgccaccggc gcgttcaccc tcggcgggat cacctccgcg       600
     ctgtacctcg tgaaggcgcg cgcgccggag cgagagtccg ggtacgtcgc gcggctgccg       660
     cggcccgagg tgctcgaccg ggtctcctac cggctgcacg cgttcggctt cccggtgtgg       720
     acgttcgcgg tgctgatcac cggcccgatc tgggcgcacc aggcctggtc gtcgtactgg       780
     aactgggacc ccaaggaggt ctgggcgttc atcacctggg tcgtctacgc ggcgtacctc       840
     cacgcgcgca ccaccgccgg ctggaagggc cgcaacgccg cgatcctcgc cctggtcggc       900
     gtcgccacgc tgtggttcaa cttcatcggc atcaactact tctcgaccac cagccagcac       960
     tcctacgccg gcggcgcacc cgcgctggtc gagccggccg ctccccaatc cgacgcactc      1020
     gggtag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page