(data stored in ACNUC1104 zone)

EMBL: CP000509.PE498

CP000509.PE498       Location/Qualifiers
FT   CDS_pept        536911..537180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80048"
FT                   /db_xref="GOA:A1SE13"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE13"
FT                   /protein_id="ABL80048.1"
FT                   /translation="MKEFWIYTALRFLLFVGSLGIVAGVWFLLADSVPILWAVVIAFVI
FT                   SGAGSYFLLNRPREALARRVQTRAERMTAKIEEMRAKEDVDDEA"
     gtgaaggagt tctggatcta caccgccctg cggttcctgc tcttcgtggg ctcgctcggg        60
     atcgtcgcgg gggtgtggtt cctcctcgcc gactcggtcc cgatcctgtg ggccgtggtg       120
     atcgccttcg tgatcagtgg cgccggctcc tatttcctgc tcaaccgccc ccgcgaggcc       180
     ctggcccgcc gggtccagac ccgcgcggag cggatgaccg cgaagatcga ggagatgcgg       240
     gccaaggagg acgtcgacga cgaggcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page