(data stored in ACNUC1104 zone)

EMBL: CP000509.PE5

CP000509.PE5         Location/Qualifiers
FT   CDS_pept        5506..6072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   sco:SCO3875 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79555"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM0"
FT                   /protein_id="ABL79555.1"
FT                   /translation="MSSDEPLGSQPADLPAPAGGAEAPEHHDDGLDLAKALTRATARST
FT                   PAARKRLRKKDTPRRGRASGAHPDDRDPQLLDATLSRLVDDHGWELDLRVHGVFGRWAE
FT                   LVGAEVARHTTPESFTDGRLVVRTDSTAWATQLRLLAPTVVRRLNEELGHGTVTVIEVL
FT                   GPHGPTWKKGPRSVRDGRGPRDTYG"
     gtgagcagtg acgagccgct cggttcgcag cccgcggacc tgccggcgcc ggcagggggg        60
     gcggaggcac ccgagcacca cgacgacggc ctcgacctgg ccaaggcgct gacccgcgcg       120
     accgcgcggt ccaccccggc cgcgcgcaag aggctgcgca agaaggacac cccccggcgg       180
     ggccgggcct ccggggccca tcccgacgac cgggacccgc agctgctcga cgcgacgctc       240
     agccgcctgg tcgacgacca cggctgggag ctggacctgc gggtgcacgg ggtcttcggc       300
     cgctgggccg agctggtcgg cgccgaggtc gcccggcaca cgaccccgga gtccttcacc       360
     gacggtcgac tggtcgtgcg caccgactcg acggcctggg cgacccagct gcgactgctg       420
     gccccgaccg tggtccgccg tctcaacgag gagctcggcc acgggaccgt gaccgtcatc       480
     gaggtgctcg gcccgcacgg tccgacgtgg aagaagggcc cgcgttcggt ccgcgacggt       540
     cgcgggccac gagacaccta cggctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page