(data stored in ACNUC1104 zone)

EMBL: CP000509.PE50

CP000509.PE50        Location/Qualifiers
FT   CDS_pept        58431..59273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79600"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR5"
FT                   /protein_id="ABL79600.1"
FT                   /translation="MKAFISSVRRGLGPERDYLAELILACGHTPLRFEDFGAQDLTSRG
FT                   ACLGGVQEADVYLLILGPHYGTEVDDSGLSPTEEEFNVAMERGIPVYVFVKSGIEVDQA
FT                   QREFMDRVGNYKDGRFWAEFADNAQLGVHVARVLREHREPAPPFRQMALTRQVQVPWRT
FT                   GQLSVPQTRDGSPVLEVHVLPIESTALRPVAHLAALAVQLASDARRQGFFGHGDALDIA
FT                   SDTELAWAVRAEDRGRRGGWNEVRLDPSPASTPPGAARSPSFRPCRVTRSAAWSTSRT"
     atgaaggcgt tcatctcttc ggtccgtcgc ggactcgggc ctgaacggga ctacctggct        60
     gagctcatcc tggcttgcgg ccacacaccg ctgcggttcg aggacttcgg cgcccaggac       120
     ctcaccagcc gaggggcgtg cctcggggga gtgcaggagg ccgacgtcta cctcttgatt       180
     ctcggcccgc actacggcac cgaggtcgat gacagcggac tgtctccgac cgaggaggag       240
     ttcaacgtcg ctatggagcg cgggatcccg gtgtacgtct tcgtgaagag cggtatcgag       300
     gtcgaccagg cgcaaaggga gttcatggac cgggtcggca actacaagga cggccgcttc       360
     tgggccgaat tcgccgacaa cgcacagctc ggggtgcatg tcgcgcgtgt gctgcgcgag       420
     caccgggagc ccgcgccgcc cttccgccag atggcgttga cccgccaggt ccaggtgcca       480
     tggcgcacgg ggcagctctc ggtcccgcag acccgtgacg ggtcacccgt gctcgaggtg       540
     cacgtcctgc cgattgagtc gaccgcgctc cgtccggtcg cgcacttggc ggcgctggct       600
     gtgcagctcg caagcgacgc acgccgccag ggcttctttg gacacgggga cgcgctggac       660
     atcgcctctg acaccgagct cgcgtgggct gtgcgtgccg aggaccgtgg ccggcgcggc       720
     ggttggaacg aggtgcgcct cgacccttcg ccggcatcta cgccaccagg ggcggcgcgg       780
     tcgccatctt tcagaccctg ccgagtgaca cgctcggcag cctggtcgac gagcaggacc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page