(data stored in ACNUC1104 zone)

EMBL: CP000509.PE501

CP000509.PE501       Location/Qualifiers
FT   CDS_pept        539330..540292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0509"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, C-terminal domain protein; KEGG: tfu:Tfu_1410
FT                   O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80051"
FT                   /db_xref="GOA:A1SE16"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE16"
FT                   /protein_id="ABL80051.1"
FT                   /translation="MGMIVWSVPMRTRFRGITVREGVLLRGPADAERPGWGEWSPFLEY
FT                   DAAVAEPWLRCAEEAAAGDWPAPLRDRVPVNVTVPAVGPQQAHAIVLAGGCRTAKVKVA
FT                   EPGQTAADDQARLEAVRDALGADGRVRIDVNGLWDLDTAVASIPVLDRAAGGLEYVEQP
FT                   CASVEDLAAVRRRVDVPIAADESIRRAADPYRVRDLEAADVAVLKVQPLGGVRACLRIA
FT                   EDIGLPVVVSSALETSVGIAAGVALAAALPELPYACGLATVQLLTADVVTESLLPVGGE
FT                   LPVRAVQVDESLAPADPDRVAHWEARLAEVRALRQDRPS"
     gtgggcatga tcgtctggtc ggtgccgatg cggacccggt tccgcggcat cacggtccgc        60
     gagggggtgc tgctgcgggg ccccgccgat gccgagcggc cgggttgggg ggagtggagc       120
     ccgttcctcg agtacgacgc ggccgtcgcc gagccctggc tgcgctgcgc ggaggaggct       180
     gcggcgggcg actggccggc gccgctgcgc gaccgggtgc cggtgaacgt caccgtgccg       240
     gccgtgggac cacagcaggc gcacgcgatc gtgctggccg gcggctgccg gacggccaag       300
     gtcaaggtcg ccgagcccgg ccagaccgcg gccgacgacc aggcgcggct cgaggcggtc       360
     cgagacgcgc tgggcgcaga cgggcgggtg cgcatcgacg tcaacggcct gtgggacctc       420
     gacaccgcgg tcgcctcgat ccccgtgctc gaccgggcgg ccggtggcct cgagtacgtc       480
     gagcagccct gcgcgagcgt cgaggacctg gccgccgtac gccgccgggt cgacgtgccc       540
     atcgccgccg acgagtcgat ccgccgggcc gcggacccct accgggtgcg cgacctggag       600
     gccgccgacg tcgcggtgct caaggtgcag ccgctcggcg gggtgcgggc ctgcctgcgg       660
     atcgccgagg acatcgggct gccggtcgtg gtgtcctcgg cgctggagac cagcgtcggg       720
     atcgccgccg gggtcgcctt ggccgccgcc ctgccggagc tgccgtacgc ctgcgggctc       780
     gccaccgtgc agctgctcac ggccgatgtc gtcaccgagt cactcctgcc ggtcggcggc       840
     gagctgccgg tgcgcgcagt gcaggtcgac gagtcgctcg cgcccgccga cccggacagg       900
     gtcgcccact gggaggcgcg gctggccgag gtgcgcgcgc tgcgacagga tcgtccctcg       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page