(data stored in SCRATCH zone)

EMBL: CP000509.PE508

CP000509.PE508       Location/Qualifiers
FT   CDS_pept        complement(547044..548330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0516"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthases; PFAM: Anthranilate
FT                   synthase component I and chorismate binding protein; KEGG:
FT                   tfu:Tfu_1413 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80058"
FT                   /db_xref="GOA:A1SE23"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE23"
FT                   /protein_id="ABL80058.1"
FT                   /translation="MSTLGRVTSSPTPGDPPPAPADALVVRTVRLDLDQAASLLDLVPA
FT                   DRPVTWLRRGDGLVGWGVAAQVRTSGATRFADAVKWWSETIARADVHDDVNEPGTGLVS
FT                   FGSFAFADDPGDSILVLPRVVVGRRGDVTWLTTVGEVGPPLGPVERPAAPAAVSFADGA
FT                   LNGEQWMSVVADAVARINAGDLEKVVLARDLVATASDPVDVRWPLGRLGETYPMCWTFH
FT                   VDGMFGATPEMLVRRERGLVTSRVLAGTIRRTGDHERDLALAATLAHSSKDLEEHEYAV
FT                   RSVADALEPHCSSMNVPEAPFVLHLPNVMHLATDVAGVVHDAATVSSLQLAEALHPSAA
FT                   VGGTPTPVATALIADIEGMDRDRYAGPVGWMDASGDGEWGIALRSARLEGRTVRLFAGC
FT                   GIVADSDPAAELAEAQAKFVPVRDALTAS"
     gtgagtaccc tcggcagggt gacgagcagc cccacacccg gcgatccgcc gccggccccg        60
     gcggacgcgc tcgtcgtccg cacggtccgc ctcgatctcg accaggcggc gagcctgctg       120
     gacctggtcc cggccgaccg gccggtcacc tggttgcggc ggggcgacgg cctggtcggt       180
     tggggcgtcg ccgcccaggt gcgcaccagc ggggccaccc ggttcgccga cgccgtgaag       240
     tggtggagcg agaccatcgc tcgggcggac gtgcacgacg acgtcaacga gcctggcacc       300
     ggcctcgtgt cgttcgggtc gttcgcgttc gccgacgacc cgggcgactc gatcctggtc       360
     ctcccccgcg tggtcgtcgg acgccgcggc gacgtcacgt ggctcaccac ggtcggcgag       420
     gtcggacccc cgctcgggcc ggtggagcgt ccagcggccc cggccgcggt cagcttcgcc       480
     gacggcgcgc tgaacggcga gcagtggatg tccgtggtcg ccgacgccgt ggcacggatc       540
     aacgccggcg acctggagaa ggtcgtgctc gctcgggacc tggtcgccac ggcgagcgac       600
     ccggtcgacg tacgctggcc gttgggccgg ctcggcgaga cctatccgat gtgctggacg       660
     ttccacgtcg acggcatgtt cggggcgacc ccggagatgc tggtgcgccg cgagcgcggc       720
     ctggtgacct cgcgggtgct ggccggcacc atccgccgca ccggcgacca cgagcgcgac       780
     ctggccctgg ccgcgaccct ggcccattcc tccaaggacc tcgaggagca cgagtacgcc       840
     gtccgctcgg tcgccgacgc gctcgagccg cactgctcgt cgatgaacgt gcccgaggct       900
     ccgttcgtgc tgcacctgcc gaacgtcatg cacctggcga ccgacgtggc cggcgtggtc       960
     catgacgcgg ccaccgtgtc ctcgctccag ctcgccgagg cgctgcaccc gtcggccgcc      1020
     gtcggcggca cgccgacccc ggtcgcgacc gcgttgatcg cggacatcga gggcatggac      1080
     cgcgaccgct acgccgggcc ggtcgggtgg atggacgcct ccggcgacgg cgagtggggc      1140
     atcgccctgc gctccgcccg tctcgagggc cgcaccgtcc ggctgttcgc cggctgcggc      1200
     atcgtcgccg actccgaccc agccgcggag ctcgccgagg cccaggccaa gttcgtcccg      1260
     gtccgcgacg cgctcaccgc gtcctga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page