(data stored in ACNUC1104 zone)

EMBL: CP000509.PE509

CP000509.PE509       Location/Qualifiers
FT   CDS_pept        548444..549013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80059"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE24"
FT                   /protein_id="ABL80059.1"
FT                   /translation="MIALGLLALFAIALPKAVGEDDGAARLVLPDTLPGGYAAADDPAS
FT                   FEGGDYADQADSIAEQEKSNSAYGNRVLPEVLGHAAATRTYVLDGTKAVFVQVFDAEGG
FT                   AFAPNSIPDPEASGGAPANEVTNVGDGVCILSYGQGSTDAGPADPVFSQCQVTRDGRTV
FT                   QIGAPDVDAEDLVATADGLLDDLQGS"
     gtgatcgcgc tcgggttgct cgccctcttt gcgatcgcgc tgccgaaggc ggtcggcgag        60
     gacgacggcg ctgcccggct cgtgctcccg gacaccctgc cgggcgggta cgccgccgcc       120
     gacgaccccg cgtccttcga gggtggcgac tacgccgacc aggccgactc gatcgccgag       180
     caggagaagt ccaacagcgc ctacggcaac cgggtgctgc cggaggtgct gggtcacgcg       240
     gccgccaccc gcacgtacgt cctcgacggc accaaggccg tgttcgtgca ggtcttcgac       300
     gccgagggcg gcgccttcgc gccgaacagc atccccgacc ccgaggcctc cggcggcgcg       360
     cccgcgaacg aggtcaccaa cgtcggcgac ggggtctgca tcctcagcta cgggcagggg       420
     tcgaccgacg ccggcccggc cgacccggtc ttcagccagt gccaggtcac ccgggacgga       480
     cgcaccgtcc agatcggggc gccggacgtc gacgccgagg atctcgtcgc caccgcggac       540
     ggtctgctcg acgacctcca gggctcctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page