(data stored in ACNUC1104 zone)

EMBL: CP000509.PE51

CP000509.PE51        Location/Qualifiers
FT   CDS_pept        59586..60119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79601"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR6"
FT                   /protein_id="ABL79601.1"
FT                   /translation="MATEEEDPRDRVWRLLMEKERYTDCPREVMGALDALGVTNDVEVA
FT                   HAELTYDDTSGATDWTITAATRSTLIRIRASATRADRQVWSVGRHRDSIEYTVAPTVDV
FT                   DVRPLTDIERVELNNVGATDAWQPGAQVVQTWTFHLRGADTVELRVDTGDRFRSEAVGQ
FT                   ICSLFARQVTSRSS"
     atggcgaccg aagaagagga cccgcgcgac cgggtgtggc ggctgctcat ggagaaagag        60
     cgctacacgg actgcccgcg ggaggtgatg ggcgcgctgg atgcgctcgg agtgaccaac       120
     gacgtggagg ttgcgcacgc cgaactcacc tacgacgaca catccggtgc caccgattgg       180
     acaatcacgg ccgccacccg gtccacgctc atccggattc gagcctccgc cacccgcgcg       240
     gaccggcagg tgtggagcgt cggacgacac cgcgactcaa tcgagtacac cgtggcgcca       300
     accgtcgacg tagacgttcg accgttgacc gacatcgagc gagtcgagct gaacaacgtc       360
     ggcgccacgg acgcctggca gcccggcgcc caggtcgtgc agacctggac gttccacttg       420
     cgcggcgcag acaccgtcga actccgcgtc gacaccggcg accggttccg gagcgaggcc       480
     gttggtcaga tctgctcgtt gttcgctcgc caagtgacat cccggtcgtc ctag             534
//

If you have problems or comments...

PBIL Back to PBIL home page