(data stored in ACNUC1104 zone)

EMBL: CP000509.PE510

CP000509.PE510       Location/Qualifiers
FT   CDS_pept        complement(549035..549964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0518"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: sma:SAV3383
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80060"
FT                   /db_xref="GOA:A1SE25"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE25"
FT                   /protein_id="ABL80060.1"
FT                   /translation="MLLARRLLLLVAVAALLCAAAFVAGDALDGGSSARPAASGAGAAS
FT                   TDQPATTDPTAAPSSSDPTATPGSSPTDAPAPTAADEPTRQPTHLPTRQPTLVPGPRLL
FT                   GPGDQGDEVRDLQARLKQIYWFNTDVTGVYGDVTATAVRGFQAKREIPVTGEVDQRTLD
FT                   RLRAMTSTPTGAELHNRGNTPGALDARCRTGRVLCIDKTSSTLRWVVDGTVRQTLDVRF
FT                   GASTTPTREGVFHVYLKDADHVSRLYGSAMPYSMFFSGGQAVHYSSDFAAVGYAGASHG
FT                   CVNVRDYDALGLLYGQVRVGDTVVVYWS"
     atgttgctcg cgcgtcgcct gctgctcctc gtcgcggtgg ccgcgctgct gtgcgccgca        60
     gccttcgtgg ccggggacgc gctggacggc ggctcctcgg cgcgacccgc cgcctccggg       120
     gccggcgccg cgtccaccga ccagccggcg accaccgatc cgaccgcggc gccgagctcc       180
     tccgacccca ccgcgacacc cggcagcagc cccaccgacg ctcccgcccc cacggccgcc       240
     gacgaaccga cccggcagcc cacccacctg cccacccgcc agcccacgct cgtaccgggc       300
     ccgcgcctgc tgggcccggg cgaccagggc gacgaggtcc gcgacctgca ggcccgcctc       360
     aagcagatct actggttcaa caccgacgtc accggcgtct acggcgacgt caccgccacc       420
     gccgtacgcg gcttccaggc caagcgggag atcccggtca ccggcgaggt cgaccagcgc       480
     accctggacc ggctccgcgc gatgacgagc accccgaccg gcgccgagct gcacaaccgc       540
     ggcaacacgc cgggcgccct cgatgcgcgc tgccggaccg gtcgggtgct ctgcatcgac       600
     aagaccagct cgaccctgcg ctgggtggtc gacgggacgg tgcgacagac cctggacgtc       660
     cggttcggcg cgtcgacgac cccgacgcgg gagggtgtct tccacgtgta cctgaaggac       720
     gccgaccacg tctcgcggct ctacggctcg gcgatgccgt actcgatgtt cttctccggc       780
     ggccaggcgg tgcactactc gtcggacttc gccgccgtcg ggtacgccgg cgcctcgcac       840
     ggctgcgtca acgtgcgcga ctacgacgcg ctcggcctgc tctacgggca ggtccgcgtg       900
     ggcgacacgg tcgtcgtgta ctggtcctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page