(data stored in SCRATCH zone)

EMBL: CP000509.PE512

CP000509.PE512       Location/Qualifiers
FT   CDS_pept        551159..551518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0520"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: sma:SAV4837 putative NADH dehydrogenase
FT                   chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80062"
FT                   /db_xref="GOA:A1SE27"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE27"
FT                   /protein_id="ABL80062.1"
FT                   /translation="MELYTPVVVLVVLATVFALGGAVMAFAVGPTRYNRVKLDSYECGI
FT                   EPTPQAVGGGRFPIKYYITAMLFIVFDIEIVFLYPWAVQFDELKFFGLVEMVLFIATVF
FT                   VAYAYVWRRGGLDWD"
     atggagctct acacgcccgt ggtcgtcctg gtcgtcctgg cgaccgtctt cgccctcggc        60
     ggcgcggtga tggccttcgc ggtcggcccc acccggtaca accgggtcaa gctggactcc       120
     tacgagtgcg gcatcgagcc gactccgcag gcggtcggcg gcgggcggtt cccgatcaag       180
     tactacatca ccgcgatgct cttcatcgtc ttcgacatcg agatcgtctt cctctacccg       240
     tgggccgtgc agttcgacga gctgaagttc ttcgggctgg tcgagatggt cttgttcatc       300
     gccacggtct tcgtcgccta tgcctacgtg tggcgccgcg gcgggctcga ttgggactga       360
//

If you have problems or comments...

PBIL Back to PBIL home page