(data stored in ACNUC1104 zone)

EMBL: CP000509.PE513

CP000509.PE513       Location/Qualifiers
FT   CDS_pept        551532..552086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0521"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tfu:Tfu_2694 NADH dehydrogenase (ubiquinone),
FT                   20 kDa subunit; TIGRFAM: NADH-quinone oxidoreductase, B
FT                   subunit; PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80063"
FT                   /db_xref="GOA:A1SE28"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE28"
FT                   /protein_id="ABL80063.1"
FT                   /translation="MGIEEKLPSGVLLSTVEGLAGYMRKASFWPASFGLACCAIEMMTS
FT                   GGPKHDLGRFGMEVFRASPRQADVMIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVCA
FT                   SSGGMFNNYAVVQGVDHVVPVDMYLPGCPPRPQMLIDAILKLHDKVQHTKMGAHRAAEI
FT                   EELETAALRALPTSEMKGQLR"
     atgggaattg aggagaagct cccgagcggg gtgctgctct cgaccgtcga gggcctggcg        60
     ggctacatgc gcaaggcctc gttctggccg gcgtccttcg gcctcgcctg ctgcgcgatc       120
     gagatgatga ccagtggcgg ccccaagcac gacctgggcc gcttcggcat ggaggtgttc       180
     cgggccagcc cccgccaggc cgacgtgatg atcgtcgccg gccgggtgag ccagaagatg       240
     gccccggtgc tgcgccagat ctacgaccag atgcccgagc ccaagtgggt gctggcgatg       300
     ggtgtgtgcg ccagcagcgg cggcatgttc aacaactacg cggtcgtgca gggcgtcgac       360
     cacgtcgtcc cggtcgacat gtacctcccc ggttgcccac cccggccgca gatgctcatc       420
     gacgcgatct tgaagctgca cgacaaggtc cagcacacca agatgggcgc ccaccgcgcg       480
     gccgagatcg aggagctcga gacggcggcg ctgcgcgcgc tccccacctc cgagatgaag       540
     ggccagctgc ggtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page