(data stored in ACNUC1104 zone)

EMBL: CP000509.PE514

CP000509.PE514       Location/Qualifiers
FT   CDS_pept        552083..552835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0522"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone), 30 kDa subunit;
FT                   KEGG: rha:RHA1_ro05911 probable NADH dehydrogenase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80064"
FT                   /db_xref="GOA:A1SE29"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE29"
FT                   /protein_id="ABL80064.1"
FT                   /translation="MSDDSSDVKPGPKGPEQPAVEQSPENVPAPTGEVHQVGARHGMFG
FT                   VRGTGDTSGYGGLNQAIVLPGDAQRPYGGWFDEVADGLAAATREAGLEIAAPRVVIHRG
FT                   EITFHLRREDLLPVAQVLRDDERLRFEFCAGVSGVHYPDETGRELHAVYHLLSMTHNRR
FT                   IRLEVAVPDADPHIPSIVPVYPTNDWHERETYDMFGIIFDGHPALTRILMPDDWPGHPQ
FT                   RKDYPLGGVPVEYKGGTVPPPDQRRSYN"
     gtgagcgacg actccagcga cgtgaagccg ggcccgaagg gacccgagca gccggccgtc        60
     gagcaatccc cggagaacgt cccggcgccc acgggagagg tccatcaggt cggcgcgcgc       120
     cacggcatgt tcggcgtgcg cggcaccggt gacaccagcg ggtacggcgg cctcaaccag       180
     gcgatcgtgc tgcccggcga cgcccagcgg ccctatggcg gctggttcga cgaggtcgcg       240
     gacggcctgg ccgcagcgac ccgcgaggcc ggcctcgaga tcgcggctcc gcgggtggtg       300
     atccaccggg gtgagatcac cttccacctg cgccgcgagg acctgctgcc cgtggcacag       360
     gtgctgcgtg acgacgaacg gctgcgcttc gagttctgcg ccggcgtcag cggggtgcac       420
     taccccgacg agaccggtcg tgagctgcac gcggtctacc acctgctctc gatgacccac       480
     aaccgtcgga tccgcctcga ggtcgccgtc ccggacgccg acccgcacat cccctcgatc       540
     gtgccggtct acccgaccaa cgactggcac gagcgggaga cctacgacat gttcgggatc       600
     atcttcgacg gccacccggc gctcacccgc atcctgatgc cggacgactg gcccggccac       660
     ccgcagcgca aggactaccc gctcgggggc gttcccgtgg agtacaaggg cggcacggtc       720
     cccccgcccg accagcggag gagctacaac tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page