(data stored in ACNUC1104 zone)

EMBL: CP000509.PE515

CP000509.PE515       Location/Qualifiers
FT   CDS_pept        552835..554175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0523"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: sco:SCO4565 NADH dehydrogenase I chain D;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase, chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80065"
FT                   /db_xref="GOA:A1SE30"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE30"
FT                   /protein_id="ABL80065.1"
FT                   /translation="MADQDLYSGSSETTEGRVFTVTGQDWDSIAEGLAEDEAQERIVVN
FT                   MGPQHPSTHGVLRLILELEGETVTEARAGIGYLHTGIEKNMEYRTWTQGVTFCTRMDYL
FT                   SPFFNEMTYVLGIERLLDIEDRVPEKAQVMRVLLMELNRISSHLVAIATGGMELGALTV
FT                   MTIGFRERELVLDLFELITGLRMNHAFIRPGGVAQDMPPGALDEIRGFVALMKKRLPEY
FT                   ADLCNANPIFKGRLEGIGHLDLAGCLALGLTGPVLRSTGYPWDLRKTQPYCGYETYDFD
FT                   VQTWDTSDSYGRFRIRLNEMWESLRIIEQAADRLAGLDGAPVMIEDKKIGWPSQLAIGS
FT                   DGMGNSLDHIRHIMGESMEALIHHFKLVTEGFRVPPGQAYVPVESPRGELGAHVVSDGG
FT                   TRPFRAHFRDPSFTNLQATSVMAEGGMVADVIVAIASIDPVMGGVDR"
     atggccgacc aggatctcta ctccggctcc agcgagacga ccgagggccg ggtcttcacc        60
     gtcaccgggc aggactggga ctcgatcgcc gagggcctgg ccgaggacga ggcgcaggag       120
     cgcatcgtcg tcaacatggg cccccagcac ccttcgaccc acggggtgct ccggctgatc       180
     ctcgagctcg agggcgagac ggtgaccgag gcgcgggccg gcatcggcta cctgcacacc       240
     ggcatcgaga agaacatgga gtaccgcacc tggacgcagg gcgtgacgtt ctgcacccgg       300
     atggactacc tcagcccgtt cttcaacgag atgacctacg tgctcgggat cgagcggctc       360
     ctcgacatcg aggaccgggt gcccgagaag gcccaggtca tgcgggtcct gctcatggag       420
     ctcaaccgga tctcctccca cctggtcgcc atcgcgaccg gtggcatgga gctcggtgcg       480
     ctgaccgtga tgacgatcgg cttccgcgag cgcgagctgg tgctcgacct gttcgagctg       540
     atcaccggcc tgcggatgaa ccacgcgttc atccgtcccg gtggcgtcgc ccaggacatg       600
     ccgccgggcg cgctcgacga gatccgcggc ttcgtggcgc tgatgaagaa gcggttgccg       660
     gagtacgccg acctctgcaa cgcgaacccg atcttcaagg ggcgcctcga gggcatcggc       720
     cacctcgacc tcgccggctg cctggcgctc ggcctcaccg gcccggtgct gcgcagcacc       780
     ggctacccgt gggacctgcg caagacccag ccgtactgcg gctacgagac ctacgacttc       840
     gacgtccaga cgtgggacac ctccgactcc tacggccggt tccgcatccg cttgaacgag       900
     atgtgggagt cgctgcggat catcgagcag gccgccgacc ggctggccgg tctcgacggc       960
     gccccggtga tgatcgagga caagaagatc ggctggccca gccagcttgc gatcggcagc      1020
     gacggcatgg gcaacagcct cgaccacatc cgccacatca tgggtgagtc gatggaggcg      1080
     ctgatccacc acttcaagct ggtcaccgag ggcttccggg tgccgcccgg ccaggcctac      1140
     gtgccggtgg agtccccgcg tggcgagctc ggcgcccacg tcgtgtccga cggcggcacc      1200
     cgcccgttcc gcgcgcactt ccgcgacccg tcgttcacca acctgcaggc gaccagcgtg      1260
     atggccgagg gcggcatggt cgccgacgtc atcgtcgcga tcgcgtccat cgatccggtc      1320
     atgggaggcg tcgaccgatg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page