(data stored in ACNUC1104 zone)

EMBL: CP000509.PE52

CP000509.PE52        Location/Qualifiers
FT   CDS_pept        complement(60327..60929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79602"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR7"
FT                   /protein_id="ABL79602.1"
FT                   /translation="MCGSSNGLPFLRDDVCVSELLTQLWARVRAQLESARSQLTNPDDE
FT                   ALFLYEDLLSHNELGLALDALADVAFEQRAPGEVWQMLGGAIEAMQLEPDDSVHGGAVQ
FT                   KVLEQLAAAHDWRGLQRLLNEWDPIGVRPDLGGPDDEYSCLYVPLVDRLHAEAPVAEIA
FT                   EFLRAEPSDHFGLDPAYSRPEVFAGRLVEWYASGAPA"
     gtgtgcggtt cgtcgaatgg cctgcccttt ctccgcgatg atgtttgcgt gtcggagcta        60
     ttgacccagc tgtgggcgag agtgcgcgcc caactcgaga gtgcgcgcag ccagctgacg       120
     aatccggatg acgaggcact cttcctctac gaagacctcc tcagccacaa cgagctcggg       180
     ctcgctcttg acgcgctcgc agatgtcgcg ttcgagcagc gcgcccctgg cgaggtctgg       240
     cagatgctcg gcggcgcaat cgaagcaatg cagttggagc cggatgacag cgttcacggc       300
     ggcgccgtcc agaaggtcct ggagcagctg gctgcggcgc acgactggcg cgggctgcag       360
     cggcttctga atgagtggga ccccattggc gtccgtcccg accttggcgg gccagatgac       420
     gagtactcct gcctctacgt tccacttgtg gaccgcctgc acgccgaggc acccgtagcg       480
     gagatcgcag agttcctgcg tgctgaaccg agcgaccact tcggcctcga tcccgcctac       540
     tcccggcccg aggtgttcgc cggtcggctg gttgagtggt acgcctctgg cgcccccgcc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page