(data stored in ACNUC1104 zone)

EMBL: CP000509.PE521

CP000509.PE521       Location/Qualifiers
FT   CDS_pept        560647..561474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0529"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6; KEGG: mmc:Mmcs_1571 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80071"
FT                   /db_xref="GOA:A1SE36"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE36"
FT                   /protein_id="ABL80071.1"
FT                   /translation="MIAFWILAPVMVIAALGLLFVRKAVHAALLLAVVMMSLAVLYAAL
FT                   EAPFLFAVQIIVYTGAILMLFLFVLMLVGVDASDSVVETIRGQRVLAAIAGLGLGLVMV
FT                   LGLSQISLGTAVGLEDANSGGNIQALANILFSRYVFAFEVTSALLITAAVGAMVLAHRE
FT                   RLTPKPTQMSLAAQRMKDYAERGTHPGPLPPPGVYARHNAVDTPALLPDGTAAESSVSR
FT                   VLAARGTVRSGPAMAEDIDEIQGTLSGATHAGRDAVAPATTTEVTPATGEDAE"
     atgatcgcgt tctggatcct cgcccccgtg atggtgatcg cggcgctcgg cctcctcttc        60
     gtccgcaagg cggtgcacgc cgcgctgctg ctggccgtcg tgatgatgtc gctcgcggtg       120
     ctctacgccg ccctcgaggc gccgttcctc ttcgcggtgc agatcatcgt ctacaccggc       180
     gccatcttga tgctgttcct gttcgtgctg atgctggtcg gcgtcgacgc gtccgactcc       240
     gtcgtcgaga cgatccgcgg ccagcgggtg ctcgcggcga tcgccggcct cggcctgggc       300
     ctggtgatgg tgctcggcct cagccagatc tcgctcggca ccgccgtcgg cctcgaggac       360
     gccaactccg gcggcaacat ccaggcgctc gccaacatcc tgttctcccg ctacgtgttc       420
     gccttcgagg tcaccagcgc gctgctgatc accgcggccg tcggcgcgat ggtgctcgct       480
     caccgcgagc ggctcacccc gaagccgacg cagatgtcgc tcgccgccca acggatgaag       540
     gactacgccg agcggggcac ccacccgggg ccactgccgc cgcccggcgt ctacgcacgg       600
     cacaacgccg tggacacccc ggcgctgctg ccggacggga ccgccgccga gtcgtcggtc       660
     tcgcgcgtgc tcgcggcccg tggcacggtc cgctcgggcc cggccatggc cgaggacatc       720
     gacgagatcc agggcacgct cagcggggcg acccacgcgg gtcgtgacgc cgtggccccg       780
     gccaccacga ccgaggtcac ccccgccacc ggagaggacg ccgaatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page