(data stored in SCRATCH zone)

EMBL: CP000509.PE522

CP000509.PE522       Location/Qualifiers
FT   CDS_pept        561471..561770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0530"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: rha:RHA1_ro05919 probable NADH dehydrogenase subunit
FT                   K"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80072"
FT                   /db_xref="GOA:A1SE37"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE37"
FT                   /protein_id="ABL80072.1"
FT                   /translation="MNVTAYVVLSGILFTIGCVGVLIRRNAIVVFMCVELMLNASNLAL
FT                   VAFARQHGNLDGQIAAFFVMVVAAAEVVVGLAIIMTIFRTRRSASVDDASLLKY"
     atgaacgtga cggcctacgt ggtcctctcg gggatcctgt tcaccatcgg ctgcgtcggc        60
     gtgctgatcc ggcgcaacgc gatcgtggtc ttcatgtgcg tcgagctgat gctcaacgcc       120
     tcgaacctcg cactggtcgc cttcgcccgc cagcacggca acctcgacgg gcagatcgcc       180
     gcgttcttcg tgatggtcgt cgccgccgcc gaggtggtcg tggggctcgc gatcatcatg       240
     accatcttcc ggacccgccg ctcggcctcg gtcgacgacg ccagcctgct gaagtactag       300
//

If you have problems or comments...

PBIL Back to PBIL home page