(data stored in ACNUC1104 zone)

EMBL: CP000509.PE523

CP000509.PE523       Location/Qualifiers
FT   CDS_pept        561784..563715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0531"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: nfa:nfa26570 putative NADH dehydrogenase I
FT                   chain L; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; PFAM: NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5/L domain protein;
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80073"
FT                   /db_xref="GOA:A1SE38"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE38"
FT                   /protein_id="ABL80073.1"
FT                   /translation="MYALNEGAIPVVHAASADGVYSLLWLVVALPLAGAAILLVGGRYT
FT                   DKWGHLLGTLLPVVSFILSLVLFFDLLGRDEGDRQFNQHVFTWFQTGHLDVGMDLLYDP
FT                   LSALFLLLITGVGSLIHVYSIGYMAHDPRRRRFFGYLNLFVAAMLLLVLSENYLGLFLG
FT                   WEGVGLASYLLIGFWQHRPSAAAAGKKAFVINRVGDMGMSTAIMMFYVTFGSTSFTVIS
FT                   ANAPGASDTQLTILGLLLLLGACAKSAQFPLQAWLLDAMEGPTPVSALIHAATMVTAGV
FT                   YLIVRSNFIFEAAPHAQTAVVVVALISILWGAAIGCAKDDIKKGLAGSTMSQIGYMMLG
FT                   AGLGAAGYAFAIFHLLTHGFFKANMFLGAGSVMHGMNDDVDMRHYGALRKMMPVTFLTF
FT                   AMGYLAIIGFPGFSGFWSKDKIIETALADNWLVGLCAIIGAGVTGFYMTRMMLMTFFGD
FT                   DRRWEKDVHPHESPSVMTVPLVVLAALSVLGGLMLAGDWIQDFLAPVVGVGAHDDPPVP
FT                   ALLVTAIIVVVVGAGVALAWMLFGRREIPRTAPQDVSFVTRAAREELYGNQINDGLVVN
FT                   PGRHLVGGLLTIDKHVIDGTFTGGPVALGSFAGVARRVQNGFVRTYALSLLGGALIVVL
FT                   ALLAVNLA"
     atgtacgcat tgaacgaggg cgccatcccg gtggtgcacg ccgcgagcgc cgacggcgtc        60
     tactcgctgc tgtggctggt ggtcgcgctg ccgctcgccg gcgccgcgat cctgctggtc       120
     ggtggcaggt acaccgacaa gtgggggcac ctgctcggca cgctcctgcc ggtcgtgtcc       180
     ttcatcctgt cgctggtcct gttcttcgac ctgctcggcc gtgacgaagg cgatcgccag       240
     ttcaaccagc acgtgttcac ctggttccag accggtcacc tcgacgtggg catggacctg       300
     ctgtacgacc cgctgtcggc gctgttcctg ctgctgatca ccggtgtcgg atcgctgatc       360
     cacgtctact cgatcggcta catggcccac gacccgcgtc gtcgccggtt cttcggctac       420
     ctgaacctgt tcgtcgcggc gatgctgctg ctggtgctct cggagaacta cctcgggctg       480
     ttcctcggct gggagggtgt cggcctcgcg tcgtacctcc tcatcggctt ctggcagcac       540
     cggccgtcgg ccgcggcggc agggaagaag gccttcgtca tcaaccgggt cggcgacatg       600
     ggcatgtcga cggcgatcat gatgttctac gtgaccttcg ggtcgacgag cttcaccgtg       660
     atcagtgcga acgcaccggg cgcctcggac acccagctca ccatcctcgg gctgctgctc       720
     ctgctcggcg cctgcgccaa gtccgcccag ttcccgctgc aggcctggct gctcgacgcg       780
     atggaaggcc cgacgccggt gtcggcgctg atccacgccg cgaccatggt gaccgcgggc       840
     gtctacctga tcgtccgctc gaacttcatc ttcgaggcgg cgccgcacgc gcagaccgcc       900
     gtcgtggtgg tcgccctgat ctcgatcctc tggggtgctg cgatcggatg cgccaaggac       960
     gacatcaaga agggcctggc gggctcgacg atgagccaga tcggatacat gatgctcggc      1020
     gccggcctgg gcgcagcggg ctacgcgttc gcgatcttcc acctgctgac gcacggcttc      1080
     ttcaaggcca acatgttcct cggagccggc tcggtcatgc acggcatgaa cgacgacgtc      1140
     gacatgcgcc actacggcgc gctgcgcaag atgatgccgg tgaccttcct gaccttcgcg      1200
     atgggctacc tcgcgatcat cgggttcccg ggcttctccg ggttctggtc gaaggacaag      1260
     atcatcgaga ccgcgctggc cgacaactgg ctggtcggac tctgcgcgat catcggcgcc      1320
     ggcgtcaccg ggttctacat gacccggatg atgctgatga ccttcttcgg tgacgaccgg      1380
     cgctgggaga aggacgtgca cccccacgag tcaccctcgg tgatgacggt gccgctggtc      1440
     gtcctcgcgg cactctcggt cctcggcggc ctgatgctcg ccggcgactg gatccaggac      1500
     ttcctggcgc ccgtcgtcgg ggtcggcgcc cacgacgacc caccggtgcc cgccctcctg      1560
     gtcaccgcga tcatcgtggt cgtcgtcggc gccggtgtcg cgctcgcctg gatgctgttc      1620
     ggccggcgcg agatcccgcg gaccgctccg caggacgtgt cgttcgtgac ccgggcggcc      1680
     cgtgaggagc tctacggcaa ccagatcaac gacggcttgg tcgtgaaccc cggtcgccac      1740
     ctggtgggtg ggctcctgac gatcgacaag cacgtcatcg acggcacctt caccggcggc      1800
     ccggtcgcgc tcgggtcctt cgccggggtc gcccggcggg tccagaacgg cttcgtccgc      1860
     acctacgccc tgtccctcct cggcggcgcc ctcatcgtcg tcctcgctct cctggcggtg      1920
     aatctcgcat ga                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page