(data stored in SCRATCH zone)

EMBL: CP000509.PE524

CP000509.PE524       Location/Qualifiers
FT   CDS_pept        563712..565241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0532"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05921 probable NADH dehydrogenase
FT                   subunit M; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80074"
FT                   /db_xref="GOA:A1SE39"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE39"
FT                   /protein_id="ABL80074.1"
FT                   /translation="MNDLPWLTALWVLPLVGALVTAFVPRATGSALPKQVGLLFALLTL
FT                   AVGIAIAVQYDTGDGMQLTETHTWIEAFGVNYALGVDGLGLLLILMTVALVPLVLVATW
FT                   NDADDRSSAAFVAWALALESFSLAVFAATDVFLFYMVFEATLIPAYFLIGRFGQAGRGR
FT                   AALKFLMYQLGGGLVLLASVIGLYVVSADAGNPSYLLSDLQQLDLSTNTERWLFVGFMI
FT                   AFAVKAPLFPLHTWLADTTEKATPGTSVLLVCILDKIGTFGMLRFGLGLFPEASQWATP
FT                   VVVALALVSIVYGALVAIGQDDILRLIGLTSLSHFGFITLGIFAFSSQGGSGAILYMVN
FT                   HGVGTAALFLIAGYLIRRKGTQLISQIAGVETKAPLLAGLFLVAGLSTLGLPGLSQFVS
FT                   EILVLISAFDYHWWVGAIAVTGIVLAAIYVLWLYQRTMTGPATPGDEAMTDLNRRELVA
FT                   VVPLIAALVFFGFFPMPLLDVSNPTVDSLLQHVGVSDEAPTVADHAEEGAH"
     atgaacgacc ttccctggct caccgcgctc tgggtgctgc cgctggtcgg cgccctggtg        60
     acggcgttcg tgccccgggc gaccgggtcg gcgctgccca agcaggtcgg gctgctgttc       120
     gcgctcctca cgctcgccgt gggcatcgcg atcgccgtcc agtacgacac cggcgacggc       180
     atgcagctga ccgagacgca cacctggatc gaggccttcg gcgtcaacta cgccctgggc       240
     gtcgacggcc tcgggctgct gctcatcctg atgacggtcg ccctggtccc gttggtgctg       300
     gtggccacct ggaacgacgc cgacgaccgc tcgtccgcgg ccttcgtggc ctgggcgctc       360
     gcgctcgagt cgttctccct cgcggtgttc gccgccaccg acgtcttcct cttctacatg       420
     gtcttcgagg cgacgctgat cccggcgtac ttcctcatcg gccgcttcgg ccaggccggt       480
     cgcggtcgcg ccgcgctgaa gttcctcatg tatcagctcg gcggcggcct ggtgctgctg       540
     gcgtcggtga tcgggctcta cgtcgtctcg gccgacgccg gcaacccgtc ctacctgctc       600
     tccgacctgc agcagctcga cctgagcacc aacaccgagc gctggctgtt cgtcgggttc       660
     atgatcgcgt tcgcggtgaa ggccccgctg ttcccgctgc acacctggct ggccgacacg       720
     accgagaagg cgacgcccgg caccagcgtg ctgctggtct gcattctcga caagatcggc       780
     accttcggga tgctgcgctt cggcctgggc ctgttcccgg aggcctcgca gtgggcgacg       840
     ccggtcgtcg tcgcgctcgc gctggtctcg atcgtgtacg gcgcgctggt cgcgatcggc       900
     caggacgaca tcctgcgcct gatcggcctg acctcgctga gccacttcgg cttcatcacc       960
     ctgggcatct tcgcgttcag cagccagggc gggtccggcg cgatcctcta catggtcaac      1020
     cacggtgtcg gcacggcggc gctcttcctg atcgccggct acctgatccg gcgcaagggc      1080
     acccagctga tcagccagat cgccggcgtc gagaccaagg cgccgctgct cgccgggctg      1140
     ttcctggtcg ccgggctctc cacgctgggc ctgcctggcc tgagccagtt cgtctccgag      1200
     atcctcgtgc tgatctcggc cttcgactac cactggtggg tcggcgcgat cgccgtcacg      1260
     ggcatcgtgc tcgccgcgat ctacgtgctc tggctctacc agcgcacgat gaccgggccg      1320
     gcgacgccgg gcgacgaggc gatgaccgac ctgaaccggc gcgagctggt cgcggtggtg      1380
     cccctgatcg ccgcgctggt gttcttcggc ttcttcccga tgccactgct cgacgtcagc      1440
     aatccgacgg tcgactccct gctgcaacac gtcggcgtgt ccgacgaggc tccgacggtc      1500
     gctgaccacg ccgaggaagg tgcgcactga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page