(data stored in SCRATCH zone)

EMBL: CP000509.PE525

CP000509.PE525       Location/Qualifiers
FT   CDS_pept        565241..566842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0533"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05922 probable NADH dehydrogenase
FT                   subunit N; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80075"
FT                   /db_xref="GOA:A1SE40"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE40"
FT                   /protein_id="ABL80075.1"
FT                   /translation="MDFIKPTIEYGDVWPLLVVFGVAAVGVLVEGFVPRAQRYLVQAAL
FT                   AIAGVVVALVGTILVARDLDVLGDGAARGAIDVEGTIAVDGPALFIWGMLLVFALGGAL
FT                   LFAERRLEGGVSAFAGQAAALPGTEAERQASTRGLEHTEVYPLMMFALGGMMLFAAAND
FT                   LLTLFVALEVLSLPLYLLSGLARRRRLLSQEAALKYFMLGAFSSGFFLYGAALVYGFSG
FT                   SMGFAEINEAVRDDVGNQTLLLIGIGMLSVGLLFKVGAVPFHSWTPDVYQGAPTAVTAF
FT                   MAAGTKIAAFGAMLRLFYVAFGSDRWSWQPMLWIIAILTMLVGALIAIVQTDMKRMLAY
FT                   SSVAHTGFLLTGVLGVQQASELADGEVTSLQAVLFYLVTYGFAVVGAFAVVTLVRDAGG
FT                   EAGQFVRWRGIGRRSPLVAGVFAFFLLSMAGIPLTAGFVGKWAVFTVALAAGAWPVVIA
FT                   AVLCSIIAVFFYVRVILLMFFEDDDVSAQGEVASVTKPSVLTSATIFVGVAATLVLGVV
FT                   PGPVLDLAANAGQFVR"
     atggacttca tcaagcccac gatcgagtac ggcgacgtct ggccgctcct cgtggtcttc        60
     ggcgtcgccg ccgtcggcgt gctcgtcgag gggttcgtgc cccgcgccca gcgctacctc       120
     gtgcaggccg cgctggcgat cgccggcgtg gtcgtcgccc tggtcggcac gatcctcgtg       180
     gcccgcgacc ttgacgtgct cggggacggg gccgcccgcg gcgccatcga cgtcgagggc       240
     accatcgcgg tcgacggccc ggcgctgttc atctggggga tgctgctggt cttcgcgctc       300
     ggtggcgcgc tgctgttcgc cgagcgccgg ctcgagggcg gggtctcggc gttcgccggc       360
     caggccgccg cgctgcccgg caccgaggcc gagcggcagg cgtcgacgcg cggcctggag       420
     cacaccgagg tctacccgct gatgatgttc gcgctgggcg gcatgatgct gttcgcggcc       480
     gcgaacgacc tgctgacgct gttcgtcgcc ctcgaggtgc tctcgctccc gctgtacctg       540
     ctctccgggc tcgcccggcg ccgccggctg ctgagccagg aggcggcgct gaagtacttc       600
     atgctcggcg ccttctcctc cgggttcttc ctctacggtg ccgcgctcgt ctacggcttc       660
     tccggctcga tgggcttcgc cgagatcaac gaggcggtgc gcgacgacgt cggcaaccag       720
     accctgctgc tgatcggcat cggcatgctc tcggtcgggc tgctgttcaa ggtcggcgcg       780
     gtgccgttcc actcctggac gcccgacgtc taccagggcg cgcccaccgc ggtcaccgcc       840
     ttcatggcgg ccggcacgaa gatcgcggcg ttcggcgcga tgctccggct gttctacgtc       900
     gccttcggct ccgaccggtg gagctggcag ccgatgctgt ggatcatcgc gatcctcacg       960
     atgctcgtgg gtgcgctcat cgcgatcgtc cagaccgaca tgaagcggat gctcgcctac      1020
     tcgtcggtgg cccacaccgg cttcctgctc accggcgtgc tcggcgtgca gcaggcctcc      1080
     gagctggccg acggcgaggt gacctcgctg caggcggtgc tcttctacct cgtcacctac      1140
     ggcttcgcgg tcgtcggcgc gttcgcggtc gtcaccctgg tgcgcgacgc gggcggcgag      1200
     gccggccagt tcgtgcgctg gcgggggatc gggcgccgct ccccgctggt cgccggggtg      1260
     ttcgcgttct tcctgctctc gatggccggc atcccgctga ccgccggctt cgtcggcaag      1320
     tgggcggtct tcacggtggc cctcgccgcc ggcgcctggc ccgtggtcat cgcagccgtg      1380
     ctgtgcagca tcatcgcggt gttcttctac gtgcgggtga tcctgctgat gttcttcgag      1440
     gacgacgacg tcagtgccca gggtgaggtc gcgagcgtca cgaagccctc ggtcctgacc      1500
     tcggcgacga tcttcgtcgg cgtggccgcg accctggtgc tcggtgtcgt tcccggaccg      1560
     gtgctcgatc tcgccgccaa tgcaggacaa ttcgtcaggt ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page