(data stored in SCRATCH zone)

EMBL: CP000509.PE527

CP000509.PE527       Location/Qualifiers
FT   CDS_pept        complement(567946..569427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0535"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane;
FT                   KEGG: sma:SAV4873 RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80077"
FT                   /db_xref="GOA:A1SE42"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE42"
FT                   /protein_id="ABL80077.1"
FT                   /translation="MPEVSGARRVGLVDVRPGLGVPAVGPDVTPPVPVAVLGREHADLP
FT                   ALLRPVRGHPLEHLPLARGRRALLLLHDDRAVPGIDPALEVELAVPLHDRVVQVAGRLL
FT                   GPPTDRRTRNRPGGGVGRSARRLGGSRGRGQAAHAQGERGGQGRQGLTHPWGLPPRVAG
FT                   APDRPRARNLPLGPQGQTPATPSYAVRVPEPRRGLAFGFAAYAMWGAFPLYWPLLEPAG
FT                   ATEILAHRVLWSALTMGLLLLVLARTPQLRAVLRDRRVRLLLTIAAAVISVNWVTYIWG
FT                   VNNDRVVETSLGYFINPLVTVLMGVVVLHERLRPLQWMAMGLASGAVVVLAVDYGRLPW
FT                   VALILAFSFGSYGLCKKTANVGATESLAFETAVIAPFAAGYLAWLGWTGGSNFASHGAG
FT                   HALLFATTGVVTAVPLICFGAAATRVSMVTLGLLQYLAPIIQFALGVLWFHEDMPAGRW
FT                   VGFVLVWIALVVFTVEAVNHRRRQLRLTVEATTAS"
     gtgcccgagg tctcaggagc gcgtcgtgta ggtcttgtag acgtgcgtcc aggactgggc        60
     gtacccgccg taggccctga cgtaaccccg ccagtaccag ttgccgtgct cgggcgcgag       120
     cacgcggacc tgccagcgct ccttcggccc gtgcgtggac acccgcttga acaccttcca       180
     cttgcacgtg gccgacgagc actgcttctt ctgcacgacg accgggccgt gcccgggatc       240
     gacccggccc ttgaagtaga gcttgccgtt ccgcttcacg atcgagtcgt gcaggtcgcg       300
     ggtcggctgc tcggtccccc gaccgaccgg cgcactcgca atcgtccggg cggcggcgtc       360
     ggccgcagcg ctcgccgcct gggcgggtcc cgcggccgcg gtcaggccgc ccacgcccag       420
     ggcgagcgcg gcggtcaggg tcgtcagggt ctgacgcatc cgtggggtct ccctccgaga       480
     gtcgcgggcg ctcctgatcg gccccgtgcc cgaaacctgc ccctgggccc tcagggccaa       540
     acgcctgcga cgccctctta tgctgtgcgg gtgccggaac cgcgtcgtgg gcttgcgttc       600
     gggttcgcgg cgtacgccat gtggggagcc ttcccgctct actggccgtt gctggagccc       660
     gccggggcga ccgagatcct cgcacaccgc gtgctctggt ccgccctcac gatgggcctc       720
     ctcctgctgg tgctggcccg gacgccgcag ctgcgcgcgg tgctgcgcga ccggcgcgtc       780
     cggctcctgc tgaccatcgc cgccgcggtg atcagtgtga actgggtgac ctacatctgg       840
     ggcgtcaaca acgaccgggt cgtcgagacc tccctgggat acttcatcaa cccgctcgtg       900
     accgtgctga tgggtgtcgt ggtcctccac gagcggctgc gcccgctgca atggatggcg       960
     atggggctcg cgtccggagc ggtcgtcgtc ctcgctgtcg actacgggcg actgccatgg      1020
     gtggccctga tcctggcgtt ctcgttcggc agctacggcc tgtgcaagaa gaccgcgaac      1080
     gtcggggcga ccgagagcct cgcgttcgag accgccgtga tcgctccgtt cgccgccggc      1140
     tacctggcct ggctgggttg gaccggcggg tcgaacttcg ccagccacgg cgcgggtcac      1200
     gcgctgctgt tcgccacgac cggcgtcgtc accgccgtac cgctgatctg cttcggcgcg      1260
     gccgcgaccc gggtgtccat ggtgaccctg ggcctgctgc agtacctcgc gccgatcatc      1320
     cagttcgccc tcggagtgct gtggttccac gaggacatgc ctgccggccg ctgggtcggg      1380
     ttcgtcctgg tctggatcgc cctggtggtg ttcaccgtcg aggcggtcaa ccaccgccgc      1440
     cgccagctgc gcctcaccgt cgaggccacc accgcgagct ag                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page