(data stored in ACNUC1104 zone)

EMBL: CP000509.PE528

CP000509.PE528       Location/Qualifiers
FT   CDS_pept        complement(569507..570622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0536"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sma:SAV4876 2-oxoglutarate ferredoxin
FT                   oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80078"
FT                   /db_xref="GOA:A1SE43"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE43"
FT                   /protein_id="ABL80078.1"
FT                   /translation="MTTDLNFPGLRSGVELVPTTDQSQTGKDYTSDQEVRWCPGCGDYA
FT                   VLKAVQGFLPDLGLRRENIVFISGIGCSSRFPYYLDTYGMHSIHGRAPSIATGIATARE
FT                   DLSVWVVTGDGDALSIGGNHLIHALRRNVNMTILLFNNRIYGLTKGQYSPTSEAGKITK
FT                   STPMGSLDHPFNPVSLALGAEGSFVARTIDSDRKHLTSVLSAAAAHRGTSFVEIYQNCP
FT                   IFNDGAFDALKSPDTKADAIIPLVHGEPIRFGAPDSNGLGTKGLIRDVGPGGTGGVKIV
FT                   DLADLGDAAEDKVLVHDAYNPDPSTAFAISRLTDSGYLHQSPIGIFRQVERPTYDDQAR
FT                   AQVSEAKAAHPGDRSERLAALIGGGDTWTVV"
     atgaccaccg acctcaactt cccgggcctg cgctcgggcg tcgagctggt cccgaccacc        60
     gaccagtcgc agaccggcaa ggactacacc tccgaccagg aggtgcgctg gtgccccggc       120
     tgcggtgact acgcggtgct caaggccgtg caggggttcc tgcccgacct ggggctgcgc       180
     cgggagaaca tcgtcttcat ctccggcatc ggctgctcca gccgcttccc ctactacctc       240
     gacacctacg ggatgcactc catccacggc cgggccccct cgatcgcgac cggcatcgcc       300
     accgcccggg aggacctctc cgtgtgggtg gtcaccggtg acggcgacgc gctgtccatc       360
     ggcggcaacc acctgatcca cgccctgcgc cgcaacgtga acatgacgat cctgctgttc       420
     aacaaccgca tctacgggct gaccaagggg cagtactccc ccacctccga ggccggcaag       480
     atcaccaagt ccaccccgat gggctccctg gaccacccgt tcaacccggt ctcgctcgcg       540
     ctcggcgccg agggcagctt cgtcgcccgc accatcgact ccgaccgcaa gcacctgacc       600
     tcggtgctct ccgcggccgc cgcccaccgg ggtacgtcgt tcgtggagat ctaccagaac       660
     tgcccgatct tcaacgacgg cgccttcgac gccttgaagt cccccgacac caaggccgat       720
     gcgatcatcc cgctggtcca cggcgagccg atccggttcg gcgcccccga cagcaacggc       780
     ctgggcacca agggcctgat ccgcgacgtc ggacctgggg ggaccggcgg cgtcaagatc       840
     gtcgacctgg ccgacctcgg cgatgcggcc gaggacaagg tgctggtcca cgacgcctac       900
     aaccccgacc cgtccacggc gttcgcgatc tcccggctca ccgactccgg ctacctccac       960
     cagtccccga tcggcatctt ccgccaggtc gagcgaccca cgtacgacga ccaggcccgc      1020
     gcccaggtca gcgaggcgaa ggccgcgcac cccggcgacc gctccgagcg cctcgccgcc      1080
     ctgatcggcg gcggcgacac ctggaccgtc gtctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page