(data stored in SCRATCH zone)

EMBL: CP000509.PE530

CP000509.PE530       Location/Qualifiers
FT   CDS_pept        572921..573958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0538"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: mmc:Mmcs_3482 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80080"
FT                   /db_xref="GOA:A1SE45"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE45"
FT                   /protein_id="ABL80080.1"
FT                   /translation="MKTSIKVAAAAFAGVLALTGCSASADGDADETVNVNAFSVMEAAN
FT                   EPVFADFAATEEGKGVRFETSYGASGDQSRAVVAGAAADVVHYSLETDVTRLVDEGLVA
FT                   EDWKDDATNGIATSSVVVFVVRKGNPENIQTWDDLVKPGVEIITPNPGSSGSARWNILA
FT                   AWAHVTGNGGSAEDAKSFLTRLLDNTIALPGSGREATTAFTDGSGDVLLSYENEAILAK
FT                   QSGADVDYVLPPDTLLIENPAAVTVDADETAQAFLEFMTSPEAQADYAQSGFRPVVDGV
FT                   DIGAVEGANDPSDPFPAPDRLFTIDGDFGGWGEAADKYFGDGEEGHPLGIITELQQQTG
FT                   KVGEE"
     atgaagactt cgatcaaggt ggcggcggcc gcgttcgccg gggtgcttgc cttgaccggc        60
     tgctccgcct ctgcggacgg cgacgccgac gagaccgtca acgtcaacgc gttctcggtg       120
     atggaggcgg ccaacgagcc cgtcttcgcc gacttcgcgg ccacggagga gggcaagggg       180
     gttcggttcg agacgtcgta cggcgcctcc ggtgaccaga gccgtgccgt cgtggccggc       240
     gcggccgcgg acgtcgtgca ctactccctc gagaccgacg tgacccggct cgtcgacgag       300
     ggcctggtgg ccgaggactg gaaggacgat gcgaccaacg gcatcgcgac gtcgtcggtc       360
     gtcgtgttcg tggtccgcaa gggcaacccc gagaacatcc agacctggga cgacctggtc       420
     aagcccggcg tcgagatcat cacgcccaac ccgggctcgt ccggctcggc ccgctggaac       480
     atcctggccg cctgggcgca cgtgaccgga aacggcggca gcgctgagga cgcgaagtcg       540
     ttcctcaccc ggctgctcga caacacgatc gccctcccgg gctctggccg ggaggccacc       600
     acggccttca ccgacggctc cggcgatgtg ctgctctcct acgagaacga ggcgatcctc       660
     gccaagcaga gcggcgcgga cgtcgactac gtgctgccgc cggacacgct gctgatcgag       720
     aacccggccg ccgtcaccgt cgacgcggac gagaccgccc aggcgttcct cgagttcatg       780
     acctcgccgg aggcgcaggc cgactacgcc cagtcgggct tccgcccggt cgtcgacggc       840
     gtcgacatcg gtgcggtcga gggcgccaac gatccgtcgg acccgttccc cgcacccgac       900
     cggctgttca cgatcgacgg cgacttcggg ggttggggtg aggcagccga caagtacttc       960
     ggtgacggcg aggaggggca ccccctcggc atcatcaccg agctgcagca gcagaccggc      1020
     aaggtgggcg aggagtaa                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page