(data stored in ACNUC1104 zone)

EMBL: CP000509.PE533

CP000509.PE533       Location/Qualifiers
FT   CDS_pept        575669..576688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0541"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: mpa:MAP2210c sulfate transport system
FT                   ATP-binding protein; TIGRFAM: sulfate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80083"
FT                   /db_xref="GOA:A1SE48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE48"
FT                   /protein_id="ABL80083.1"
FT                   /translation="MSIEVSGVTKRFGDFVALDDVSVSLPTGQLTALLGPSGGGKSTLL
FT                   RIIAGLDTADEGTVSIEGVDATRLPPQKRNVGFVFQHYAVFKHLTVAKNVAFGLEIRTH
FT                   GGLRPPWAPRRRTDRDRIQAKVDELLRLVHLTQFAHRLPAQLSGGQRQRMALARALAVE
FT                   PSVLLLDEPFGALDAKVRKELRGWLRRLHDEVHVTTVFVTHDQEEAMEVADEIVVINEG
FT                   RVEQVGTPDQLYDEPANDFVMGFLGDITTLNGVRLRPHDVHISRSPQFSGAAEGTVSRL
FT                   LRVGFEVRATVLTDDGDEVTVVLTRAHARQLGLEAGSPVWVTPASGAAVIPAMLPTPA"
     gtgagcatcg aagtctcagg agtcaccaag cggttcggtg acttcgtcgc cctcgacgac        60
     gtcagcgtgt cgctgcccac cggtcagctg accgccctgc tgggtccgtc cggcggcggc       120
     aagtccacgc tgctgcggat catcgccggc ctggacaccg ccgacgaggg aaccgtcagc       180
     atcgagggcg tcgacgccac caggctgccg ccccagaagc gcaacgtcgg cttcgtcttc       240
     cagcactacg cggtcttcaa gcacctgacc gtggcgaaga acgtcgcgtt cggcctcgag       300
     atccggaccc acggggggct ccggcccccg tgggcccccc ggcggcgtac ggatcgagac       360
     cgcatccagg ccaaggtcga cgagctgctc cggctcgtgc acctcacgca gttcgcccac       420
     cggctgcccg cccagctgtc cggtggccag cgccagcgga tggcgctggc ccgggcgctg       480
     gcggtcgagc cgtcggtgct cctgctggac gagccgttcg gagcgctgga cgcgaaggtg       540
     cgcaaggagc tgcgggggtg gctgcgccgc ctgcacgacg aggtgcacgt gacgacagtg       600
     ttcgtcaccc acgaccagga ggaggcgatg gaggtcgccg acgagatcgt ggtgatcaac       660
     gagggccggg tggagcaggt cggtacgccc gaccagctct acgacgagcc cgcgaacgac       720
     ttcgtgatgg gcttcctggg cgacatcacc accctcaacg gggtgcggct gcgcccccac       780
     gacgtacaca tctcgcgctc gccgcagttc tccggcgcgg ccgagggcac ggtgtcgcgg       840
     ctgctgcggg tcgggttcga ggtccgggcg acggtgctga ccgacgacgg tgacgaggtg       900
     accgtggtgc tcacccgggc ccacgcgcgt cagctcggac tcgaggccgg ttcgccggtg       960
     tgggtcaccc cggcctcggg tgccgccgtc atccccgcca tgttgcccac ccccgcctag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page