(data stored in ACNUC1104 zone)

EMBL: CP000509.PE535

CP000509.PE535       Location/Qualifiers
FT   CDS_pept        complement(577710..578474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0543"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rxy:Rxyl_1898 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80085"
FT                   /db_xref="GOA:A1SE50"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE50"
FT                   /protein_id="ABL80085.1"
FT                   /translation="MAEDFAEGLPAGLHSAAPGTLHSRISAWLRERIATGAWPPHYRLK
FT                   PEPELAAALGVSRGTLRRALATLIAEGALVQVRGKGTFVTSTLVEPAIAQKLTSLAEDF
FT                   ADQGSPLSTEVLECRLLTPPAPVAALLDTPVGRPILHLVRLRSTPEGPVALLDNYVRTD
FT                   LAPGLEETDFTEATLFGALASRHGLHIATGRRTFTATLADQKQAALLDLAPGSPLQHLE
FT                   QVTYLGDGSPIEYSDVWIRSDRLRVTSLLTRH"
     atggcggagg acttcgcgga gggattgcct gcgggcctgc acagtgctgc cccaggcacc        60
     cttcactcca ggatctcggc ctggttgcgc gaacggatcg ccaccggcgc gtggccgccc       120
     cactaccggc tcaagcccga gccggagctc gccgcggcgc tcggcgtgag ccggggcacc       180
     ctgcggcgcg ccctggccac cctgatcgcc gagggcgccc tcgtgcaggt ccgtggcaag       240
     ggcaccttcg ttacctccac gctcgtcgag cccgccatcg cccagaagct gaccagcctg       300
     gccgaggact tcgccgacca gggcagcccg ctgagcaccg aggtgctcga gtgccgactg       360
     ctcacgccgc ccgcgccggt cgcggccctg ctggacacgc ccgtcggccg cccgatcctg       420
     cacctggtgc ggctgcggag cacccccgag ggaccggtcg cgctgctcga caactacgtc       480
     cgcaccgacc ttgcccccgg cctggaggag accgacttca ccgaggccac cctgttcggg       540
     gcgctcgcca gccggcacgg cctgcacatc gcgaccggtc gtcgcacctt caccgccacg       600
     ctcgccgacc agaagcaggc agcgttgcta gatctcgcgc ccggcagccc gctgcagcac       660
     ctcgagcagg tgacctacct cggcgacggc tcgccgatcg agtactccga cgtctggatc       720
     cgctccgacc ggctccgcgt cacctccctg ctgacccgcc actga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page