(data stored in ACNUC1104 zone)

EMBL: CP000509.PE537

CP000509.PE537       Location/Qualifiers
FT   CDS_pept        complement(579216..580130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0545"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rxy:Rxyl_1888 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80087"
FT                   /db_xref="GOA:A1SE52"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE52"
FT                   /protein_id="ABL80087.1"
FT                   /translation="MRIAVVGSYGVGMTMRMPRLPVAGETLLGGEYRSGHGGKGSNQAV
FT                   AASRLGAEVTLLTAVGGDAIGRAARDMWAAEGVDATATITAPAATMVGMILVEPSGENR
FT                   IVIATGALDHLTPRHVQDFAPQLAAADIAVVSLEIPMATAVAALRAAHEAGTRTLLNPA
FT                   PAQPIPDEAWSNVDLLTPNRTEAAILLGLPPDAAGPAEELARQLHERGGATIVLTLGAE
FT                   GALICDAGGLTPVAAVPPAEVVDTTGAGDAFTAALAVELAGGGSVPGAVAFAARVGAFA
FT                   VAHHEVFPGLPRRTDLDTEPDLT"
     atgcgtatcg cggtggtggg gagctacggg gtcggcatga ccatgcggat gccgcggctg        60
     ccggtggccg gcgagacgct gctcggtggc gagtaccggt ccggccacgg cggcaagggc       120
     tccaaccagg cggtcgcggc cagccggctc ggcgcggagg tcaccctgct caccgcggtc       180
     ggcggcgacg ccatcgggcg ggccgcccgc gatatgtggg ccgcggaggg cgtcgacgcg       240
     acggcgacga tcaccgcacc cgcagcgacc atggtcggga tgatcctcgt cgagcccagc       300
     ggggagaacc ggatcgtgat cgccaccggc gcgctggacc acctcacccc ccggcacgtg       360
     caggacttcg caccgcagct cgcggccgct gacatcgcgg tcgtctcgct cgagatcccg       420
     atggcgacgg ccgtcgccgc cctccgggcc gcgcacgagg ctggcacccg cacgctgctc       480
     aatcccgccc cggcccaacc gatccccgac gaagcctggt cgaacgtcga cctgctcact       540
     ccgaaccgca ccgaggcggc gatcctgctc gggctgcctc ccgacgcggc cggaccggcc       600
     gaggagctgg cccggcagct ccacgagcgc ggcggcgcca cgatcgtgct gaccctgggc       660
     gccgagggcg ccctgatctg tgacgccggc ggcctcaccc cggtggcggc cgtccctccc       720
     gccgaggtgg tcgacaccac cggtgccggc gacgccttca ccgccgccct ggccgtcgag       780
     ctggccggcg gcggctcggt cccgggcgcc gtggcgttcg cagcccgggt cggcgccttc       840
     gccgtcgcgc atcacgaggt cttccccggt ctgccgcgcc ggaccgacct cgacaccgaa       900
     cccgacctca cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page