(data stored in ACNUC1104 zone)

EMBL: CP000509.PE538

CP000509.PE538       Location/Qualifiers
FT   CDS_pept        580692..581231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80088"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE53"
FT                   /protein_id="ABL80088.1"
FT                   /translation="MNESSRSLSTTTCPDWCIDNDHSQEVNEQLGDGPLHQGPAFGGRL
FT                   RAWGLDDADGRTLSIDFEDRSDFGTPEQLRALAQAAEEAARWLEEQGMSHQPPAGSADR
FT                   APAPRLLDALALREAEGFLTIDEAAERYGIDRGVLAAEAAAGRVGTVSLRFDDTIEATF
FT                   LPTHDEAVAAWLEAHR"
     atgaacgaat catcccggag cctgagcacc accacatgcc ccgactggtg cattgacaac        60
     gaccacagcc aagaggtcaa cgagcagctc ggcgatgggc ctctgcacca ggggccggcc       120
     ttcggcgggc ggttgcgcgc ctggggcctc gacgacgcgg atggtcggac gctctcgatc       180
     gacttcgagg accgtagcga cttcggtacg ccggagcagc tccgcgcgct cgcccaggca       240
     gcggaggagg cggcgcgctg gctggaggag cagggcatga gccaccagcc gccggccggg       300
     tccgccgatc gggccccggc gcctcgcctg ctcgatgccc tcgcccttcg tgaggccgag       360
     ggctttctga ccatcgacga ggccgcggag cggtacggca tcgatcgggg agtcctcgcc       420
     gcggaggccg cggccggtcg cgtcgggacc gtgtccctga ggttcgacga caccatcgag       480
     gcgacgttcc tgccgacgca tgacgaggca gtggcggcgt ggctggaggc gcaccggtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page